Gene Gene information from NCBI Gene database.
Entrez ID 334
Gene name Amyloid beta precursor like protein 2
Gene symbol APLP2
Synonyms (NCBI Gene)
APLP-2APPHAPPL2CDEBP
Chromosome 11
Chromosome location 11q24.3
Summary This gene encodes amyloid precursor- like protein 2 (APLP2), which is a member of the APP (amyloid precursor protein) family including APP, APLP1 and APLP2. This protein is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at
miRNA miRNA information provided by mirtarbase database.
529
miRTarBase ID miRNA Experiments Reference
MIRT025806 hsa-miR-7-5p Microarray 17612493
MIRT025806 hsa-miR-7-5p Microarray 19073608
MIRT048819 hsa-miR-93-5p CLASH 23622248
MIRT044252 hsa-miR-106b-5p CLASH 23622248
MIRT042713 hsa-miR-346 CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003677 Function DNA binding NAS 7702756
GO:0004867 Function Serine-type endopeptidase inhibitor activity IDA 25301953
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 8855266, 9461550, 16193067, 20195357, 20936779, 21293490, 26948053, 32814053, 33961781, 34446781, 37207277
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
104776 598 ENSG00000084234
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q06481
Protein name Amyloid beta precursor like protein 2 (APPH) (Amyloid beta (A4) precursor-like protein 2) (Amyloid protein homolog) (Amyloid-like protein 2) (APLP-2) (CDEI box-binding protein) (CDEBP) (Sperm membrane protein YWK-II)
Protein function May play a role in the regulation of hemostasis. The soluble form may have inhibitory properties towards coagulation factors. May interact with cellular G-protein signaling pathways. May bind to the DNA 5'-GTCACATG-3'(CDEI box). Inhibits trypsin
PDB 5JBT , 5TPT , 8RQ6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02177 APP_N 49 147 Amyloid A4 N-terminal heparin-binding Domain
PF12924 APP_Cu_bd 148 204 Copper-binding of amyloid precursor, CuBD Domain
PF00014 Kunitz_BPTI 309 361 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
PF12925 APP_E2 365 547 E2 domain of amyloid precursor protein Domain
PF10515 APP_amyloid 709 759 Beta-amyloid precursor protein C-terminus Family
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, brain, heart, lung, liver, kidney and endothelial tissues.
Sequence
MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLN
MHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDK
KQCKSRFVTPFKCLVGEFVSDVLLVPE
KCQFFHKERMEVCENHQHWHTVVKEACLTQGMT
LYSYGMLLPCGVDQFHGTEYVCCP
QTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEF
PTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDK
EITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC
K
AMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAK
NLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQ
SDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERR
NQSLSLL
YKVPYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFH
PFHPFPALPENEDTQPELYHPMKKGSGVGEQDGGLIGAEEKVINSKNKVDENMVIDETLD
VKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLVIAVAIATVIVISLVMLRKRQ
YGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLE
QMQI
Sequence length 763
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Platelet degranulation
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MYOCARDIAL ISCHEMIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 14970211, 8863657, 9729270 Associate
★☆☆☆☆
Found in Text Mining only
Alzheimer disease, familial, type 3 Alzheimer disease BEFREE 16645641
★☆☆☆☆
Found in Text Mining only
Amyloidosis Amyloidosis BEFREE 20732423, 29663738
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis Pubtator 22351750 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 38148084 Associate
★☆☆☆☆
Found in Text Mining only
Carotid Artery Thrombosis Carotid Artery Thrombosis BEFREE 19403832
★☆☆☆☆
Found in Text Mining only
Cerebral Thrombosis Cerebral Thrombosis BEFREE 19403832
★☆☆☆☆
Found in Text Mining only
Clear-cell metastatic renal cell carcinoma Renal Carcinoma BEFREE 30655794
★☆☆☆☆
Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma Renal Carcinoma BEFREE 30655794
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease Pubtator 32716039 Associate
★☆☆☆☆
Found in Text Mining only