Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	333929
Gene name	Snail family transcriptional repressor 3
Gene symbol	SNAI3
Synonyms (NCBI Gene)	SMUCSNAIL3ZNF293Zfp293
Chromosome	16
Chromosome location	16q24.2
Summary	SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).[supplied by OMIM, Apr 2009]

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054045	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	22402125
MIRT1374805	hsa-miR-4269	CLIP-seq
MIRT1374806	hsa-miR-4733-5p	CLIP-seq
MIRT2111557	hsa-miR-3126-5p	CLIP-seq
MIRT2111558	hsa-miR-326	CLIP-seq
MIRT2111559	hsa-miR-330-5p	CLIP-seq
MIRT2111560	hsa-miR-4459	CLIP-seq
MIRT2111561	hsa-miR-4488	CLIP-seq
MIRT2111562	hsa-miR-4667-5p	CLIP-seq
MIRT2111563	hsa-miR-4697-5p	CLIP-seq
MIRT2111564	hsa-miR-4700-5p	CLIP-seq
MIRT2111565	hsa-miR-4722-5p	CLIP-seq
MIRT2111566	hsa-miR-4779	CLIP-seq
MIRT2111567	hsa-miR-486-3p	CLIP-seq
MIRT2111568	hsa-miR-637	CLIP-seq
MIRT2460082	hsa-miR-125a-5p	CLIP-seq
MIRT2460083	hsa-miR-125b	CLIP-seq
MIRT2460084	hsa-miR-146b-3p	CLIP-seq
MIRT2460085	hsa-miR-3173-5p	CLIP-seq
MIRT2460086	hsa-miR-371b-3p	CLIP-seq
MIRT2460087	hsa-miR-4319	CLIP-seq
MIRT2460088	hsa-miR-4324	CLIP-seq
MIRT2460089	hsa-miR-4329	CLIP-seq
MIRT2460090	hsa-miR-4786-5p	CLIP-seq
MIRT2460091	hsa-miR-769-5p	CLIP-seq
MIRT2460092	hsa-miR-874	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RUNX2	Activation	22641097

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005507	Function	Copper ion binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
612741	18411	ENSG00000185669

Q3KNW1

Protein name

Zinc finger protein SNAI3 (Protein snail homolog 3) (Zinc finger protein 293)

Protein function

Seems to inhibit myoblast differentiation. Transcriptional repressor of E-box-dependent transactivation of downstream myogenic bHLHs genes. Binds preferentially to the canonical E-box sequences 5'-CAGGTG-3' and 5'-CACCTG-3' (By similarity). {ECO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	183 → 205	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	209 → 231	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	237 → 259	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	265 → 286	Zinc finger, C2H2 type	Domain

Sequence

MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWD
RSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVL
PTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVG
RVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACS
HCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGP

Sequence length

292

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ENTEROCOLITIS, NECROTIZING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	31264769, 37202791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31264769, 32826862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30252597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	12579345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16142376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16142376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34288803, 37173373, 37202791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12579345, 26753613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32337289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	CTD_human_DG	18806098		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	26753613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31258781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32337289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25344116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22641097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SNAI3 (snail family transcriptional repressor 3)