Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3329
Gene name	Heat shock protein family D (Hsp60) member 1
Gene symbol	HSPD1
Synonyms (NCBI Gene)	CPN60GROELHLD4HSP-60HSP60HSP65HuCHA60SPG13
Chromosome	2
Chromosome location	2q33.1
Summary	This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria.

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs61755731	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs66468541	C>T	Pathogenic	Coding sequence variant, missense variant
rs863224042	T>C	Likely-pathogenic	Coding sequence variant, missense variant

389

Show/Hide all (389)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003976	hsa-miR-1-3p	Review	19815577
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	23226300
MIRT003976	hsa-miR-1-3p	Proteomics	18668040
MIRT024960	hsa-miR-214-3p	Microarray;Other	19859982
MIRT031799	hsa-miR-16-5p	Proteomics	18668040
MIRT048142	hsa-miR-197-3p	CLASH	23622248
MIRT045988	hsa-miR-125b-5p	CLASH	23622248
MIRT043359	hsa-miR-331-3p	CLASH	23622248
MIRT043032	hsa-miR-324-5p	CLASH	23622248
MIRT037397	hsa-miR-744-5p	CLASH	23622248
MIRT037397	hsa-miR-744-5p	CLASH	23622248
MIRT618514	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT618513	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT618512	hsa-miR-3607-5p	HITS-CLIP	23824327
MIRT618511	hsa-miR-4513	HITS-CLIP	23824327
MIRT618510	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT618509	hsa-miR-6857-3p	HITS-CLIP	23824327
MIRT618508	hsa-miR-3167	HITS-CLIP	23824327
MIRT618507	hsa-miR-876-5p	HITS-CLIP	23824327
MIRT618506	hsa-miR-134-5p	HITS-CLIP	23824327
MIRT618505	hsa-miR-3118	HITS-CLIP	23824327
MIRT618504	hsa-miR-1297	HITS-CLIP	23824327
MIRT618503	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618502	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618501	hsa-miR-4465	HITS-CLIP	23824327
MIRT618500	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT618499	hsa-miR-3136-5p	HITS-CLIP	23824327
MIRT618498	hsa-miR-4439	HITS-CLIP	23824327
MIRT618497	hsa-miR-498	HITS-CLIP	23824327
MIRT618496	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT618514	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT618513	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT618512	hsa-miR-3607-5p	HITS-CLIP	23824327
MIRT618511	hsa-miR-4513	HITS-CLIP	23824327
MIRT618510	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT618509	hsa-miR-6857-3p	HITS-CLIP	23824327
MIRT618508	hsa-miR-3167	HITS-CLIP	23824327
MIRT618507	hsa-miR-876-5p	HITS-CLIP	23824327
MIRT618506	hsa-miR-134-5p	HITS-CLIP	23824327
MIRT618505	hsa-miR-3118	HITS-CLIP	23824327
MIRT618504	hsa-miR-1297	HITS-CLIP	23824327
MIRT618503	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618502	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618501	hsa-miR-4465	HITS-CLIP	23824327
MIRT618500	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT618499	hsa-miR-3136-5p	HITS-CLIP	23824327
MIRT618498	hsa-miR-4439	HITS-CLIP	23824327
MIRT618497	hsa-miR-498	HITS-CLIP	23824327
MIRT618496	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT1056700	hsa-miR-1229	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056702	hsa-miR-1261	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056707	hsa-miR-2277-3p	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056710	hsa-miR-3137	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056714	hsa-miR-323b-5p	CLIP-seq
MIRT1056715	hsa-miR-3622b-5p	CLIP-seq
MIRT1056716	hsa-miR-3682-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT1056721	hsa-miR-4528	CLIP-seq
MIRT1056722	hsa-miR-4639-3p	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056724	hsa-miR-4684-5p	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056727	hsa-miR-4731-3p	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056729	hsa-miR-4801	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056735	hsa-miR-944	CLIP-seq
MIRT1056736	hsa-miR-1	CLIP-seq
MIRT1056700	hsa-miR-1229	CLIP-seq
MIRT1056737	hsa-miR-1244	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056702	hsa-miR-1261	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056738	hsa-miR-1912	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056739	hsa-miR-206	CLIP-seq
MIRT1056707	hsa-miR-2277-3p	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056740	hsa-miR-31	CLIP-seq
MIRT1056741	hsa-miR-3130-5p	CLIP-seq
MIRT1056710	hsa-miR-3137	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056742	hsa-miR-323-5p	CLIP-seq
MIRT1056714	hsa-miR-323b-5p	CLIP-seq
MIRT1056715	hsa-miR-3622b-5p	CLIP-seq
MIRT1056716	hsa-miR-3682-5p	CLIP-seq
MIRT1056743	hsa-miR-3688-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056745	hsa-miR-3941	CLIP-seq
MIRT1056746	hsa-miR-4299	CLIP-seq
MIRT1056747	hsa-miR-4307	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT1056748	hsa-miR-4456	CLIP-seq
MIRT1056749	hsa-miR-4482	CLIP-seq
MIRT1056721	hsa-miR-4528	CLIP-seq
MIRT1056722	hsa-miR-4639-3p	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056753	hsa-miR-466	CLIP-seq
MIRT1056754	hsa-miR-4668-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056756	hsa-miR-4672	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056724	hsa-miR-4684-5p	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056757	hsa-miR-4720-3p	CLIP-seq
MIRT1056727	hsa-miR-4731-3p	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056729	hsa-miR-4801	CLIP-seq
MIRT1056758	hsa-miR-4802-3p	CLIP-seq
MIRT1056759	hsa-miR-4804-3p	CLIP-seq
MIRT1056760	hsa-miR-488	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT1056762	hsa-miR-548c-3p	CLIP-seq
MIRT1056763	hsa-miR-548q	CLIP-seq
MIRT1056764	hsa-miR-556-3p	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056766	hsa-miR-613	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056768	hsa-miR-643	CLIP-seq
MIRT1056769	hsa-miR-760	CLIP-seq
MIRT1056770	hsa-miR-873	CLIP-seq
MIRT1056771	hsa-miR-876-3p	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056735	hsa-miR-944	CLIP-seq
MIRT1056736	hsa-miR-1	CLIP-seq
MIRT1056700	hsa-miR-1229	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056702	hsa-miR-1261	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056738	hsa-miR-1912	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056739	hsa-miR-206	CLIP-seq
MIRT1056707	hsa-miR-2277-3p	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056740	hsa-miR-31	CLIP-seq
MIRT1056741	hsa-miR-3130-5p	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056742	hsa-miR-323-5p	CLIP-seq
MIRT1056714	hsa-miR-323b-5p	CLIP-seq
MIRT1056716	hsa-miR-3682-5p	CLIP-seq
MIRT1056743	hsa-miR-3688-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT2012999	hsa-miR-4272	CLIP-seq
MIRT1056746	hsa-miR-4299	CLIP-seq
MIRT1056747	hsa-miR-4307	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT1056748	hsa-miR-4456	CLIP-seq
MIRT1056749	hsa-miR-4482	CLIP-seq
MIRT1056721	hsa-miR-4528	CLIP-seq
MIRT1056722	hsa-miR-4639-3p	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056757	hsa-miR-4720-3p	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056759	hsa-miR-4804-3p	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056763	hsa-miR-548q	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056766	hsa-miR-613	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056768	hsa-miR-643	CLIP-seq
MIRT1056770	hsa-miR-873	CLIP-seq
MIRT1056771	hsa-miR-876-3p	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056735	hsa-miR-944	CLIP-seq
MIRT1056736	hsa-miR-1	CLIP-seq
MIRT1056700	hsa-miR-1229	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056702	hsa-miR-1261	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056738	hsa-miR-1912	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056739	hsa-miR-206	CLIP-seq
MIRT1056707	hsa-miR-2277-3p	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056740	hsa-miR-31	CLIP-seq
MIRT1056741	hsa-miR-3130-5p	CLIP-seq
MIRT1056710	hsa-miR-3137	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056742	hsa-miR-323-5p	CLIP-seq
MIRT1056714	hsa-miR-323b-5p	CLIP-seq
MIRT1056715	hsa-miR-3622b-5p	CLIP-seq
MIRT1056716	hsa-miR-3682-5p	CLIP-seq
MIRT1056743	hsa-miR-3688-5p	CLIP-seq
MIRT2245294	hsa-miR-382	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056745	hsa-miR-3941	CLIP-seq
MIRT1056746	hsa-miR-4299	CLIP-seq
MIRT1056747	hsa-miR-4307	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT1056748	hsa-miR-4456	CLIP-seq
MIRT1056749	hsa-miR-4482	CLIP-seq
MIRT1056721	hsa-miR-4528	CLIP-seq
MIRT1056722	hsa-miR-4639-3p	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056753	hsa-miR-466	CLIP-seq
MIRT1056754	hsa-miR-4668-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056756	hsa-miR-4672	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056724	hsa-miR-4684-5p	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056757	hsa-miR-4720-3p	CLIP-seq
MIRT1056727	hsa-miR-4731-3p	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056729	hsa-miR-4801	CLIP-seq
MIRT1056758	hsa-miR-4802-3p	CLIP-seq
MIRT1056759	hsa-miR-4804-3p	CLIP-seq
MIRT1056760	hsa-miR-488	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056763	hsa-miR-548q	CLIP-seq
MIRT1056764	hsa-miR-556-3p	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056766	hsa-miR-613	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056768	hsa-miR-643	CLIP-seq
MIRT1056769	hsa-miR-760	CLIP-seq
MIRT1056770	hsa-miR-873	CLIP-seq
MIRT1056771	hsa-miR-876-3p	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056735	hsa-miR-944	CLIP-seq
MIRT1056742	hsa-miR-323-5p	CLIP-seq
MIRT1056743	hsa-miR-3688-5p	CLIP-seq
MIRT1056746	hsa-miR-4299	CLIP-seq
MIRT1056748	hsa-miR-4456	CLIP-seq
MIRT1056758	hsa-miR-4802-3p	CLIP-seq
MIRT1056759	hsa-miR-4804-3p	CLIP-seq
MIRT1056760	hsa-miR-488	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056763	hsa-miR-548q	CLIP-seq
MIRT1056768	hsa-miR-643	CLIP-seq
MIRT1056769	hsa-miR-760	CLIP-seq
MIRT1056771	hsa-miR-876-3p	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RUNX3	Repression	17956589

100

Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001530	Function	Lipopolysaccharide binding	IDA	17164250
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002039	Function	P53 binding	IPI	18086682
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IDA	16148103
GO:0002842	Process	Positive regulation of T cell mediated immune response to tumor cell	IDA	10663613
GO:0003688	Function	DNA replication origin binding	ISS
GO:0003697	Function	Single-stranded DNA binding	ISS
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0005515	Function	Protein binding	IPI	15846844, 17110338, 17823127, 18086682, 21516116, 21988832, 22664726, 23349634, 23840630, 24286120, 25416956, 25609649, 25910212, 26618866, 26871637, 28514442, 29568061, 29924966, 30021884, 31515488, 32296183, 32814053, 33961781, 35156780, 36012204
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	IDA	18229457
GO:0005737	Component	Cytoplasm	IDA	21328542
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	17823127, 18086682, 21245038
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	7865888
GO:0005759	Component	Mitochondrial matrix	IDA	19393246, 24746669
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS	17823127
GO:0005769	Component	Early endosome	IDA	11807771
GO:0005829	Component	Cytosol	IDA	17823127, 18086682
GO:0005886	Component	Plasma membrane	IDA	11027668
GO:0005905	Component	Clathrin-coated pit	IDA	11807771
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006458	Process	'de novo' protein folding	ISS
GO:0006986	Process	Response to unfolded protein	IDA	11050098
GO:0008035	Function	High-density lipoprotein particle binding	IDA	11027668
GO:0008637	Process	Apoptotic mitochondrial changes	IBA
GO:0009409	Process	Response to cold	ISS
GO:0009986	Component	Cell surface	IDA	9243807, 10663613, 11807771
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	ISS
GO:0019899	Function	Enzyme binding	IPI	20507888
GO:0030135	Component	Coated vesicle	IDA	11807771
GO:0030141	Component	Secretory granule	IEA
GO:0030141	Component	Secretory granule	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078, 21753002
GO:0032727	Process	Positive regulation of interferon-alpha production	IBA
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	17164250
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IBA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	17164250
GO:0032729	Process	Positive regulation of type II interferon production	IDA	17164250
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	16148103
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	17164250
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	16148103
GO:0032991	Component	Protein-containing complex	IDA	21328542, 23349634
GO:0034185	Function	Apolipoprotein binding	IPI	11027668
GO:0034186	Function	Apolipoprotein A-I binding	IPI	11027668
GO:0034514	Process	Mitochondrial unfolded protein response	IBA
GO:0042026	Process	Protein refolding	IDA	11050098
GO:0042026	Process	Protein refolding	IEA
GO:0042100	Process	B cell proliferation	IDA	16148103
GO:0042110	Process	T cell activation	IBA
GO:0042110	Process	T cell activation	IDA	15371451, 17164250
GO:0042110	Process	T cell activation	IEA
GO:0042113	Process	B cell activation	IDA	16148103
GO:0043032	Process	Positive regulation of macrophage activation	IDA	17164250
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18086682
GO:0043231	Component	Intracellular membrane-bounded organelle	IEA
GO:0044406	Process	Adhesion of symbiont to host	IDA	20633027
GO:0045041	Process	Protein import into mitochondrial intermembrane space	IBA
GO:0046696	Component	Lipopolysaccharide receptor complex	IDA	17164250
GO:0048291	Process	Isotype switching to IgG isotypes	IDA	16148103
GO:0050821	Process	Protein stabilization	IMP	18086682
GO:0050821	Process	Protein stabilization	ISS
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0050870	Process	Positive regulation of T cell activation	IDA	16148103, 17164250
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0051082	Function	Unfolded protein binding	IC	11050098
GO:0051082	Function	Unfolded protein binding	ISS
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051087	Function	Protein-folding chaperone binding	IPI	10205158
GO:0051131	Process	Chaperone-mediated protein complex assembly	ISS
GO:0051604	Process	Protein maturation	ISS
GO:0051702	Process	Biological process involved in interaction with symbiont	IMP	20507888
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070062	Component	Extracellular exosome	IDA	21276792
GO:0097225	Component	Sperm midpiece	IMP	32791035
GO:0097524	Component	Sperm plasma membrane	IEA
GO:0098761	Process	Cellular response to interleukin-7	IEA
GO:0140494	Component	Migrasome	IEA
GO:0140608	Function	Cysteine-type endopeptidase activator activity	IDA	17823127
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1900118	Process	Negative regulation of execution phase of apoptosis	IMP	17823127
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IMP	17823127

MIM	HGNC	e!Ensembl
118190	5261	ENSG00000144381

P10809

Protein name

60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (Heat shock protein family D member 1) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein)

Protein function

Chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp10, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded p

PDB

4PJ1 , 6HT7 , 6MRC , 6MRD , 7AZP , 7L7S , 8G7J , 8G7K , 8G7L , 8G7M , 8G7N , 8G7O , 8U39

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00118	Cpn60_TCP1	47 → 550	TCP-1/cpn60 chaperonin family	Family

Sequence

MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF

Sequence length

573

Interactions

View interactions

	KEGG		Reactome
	RNA degradation Type I diabetes mellitus Legionellosis Tuberculosis Lipid and atherosclerosis		Mitochondrial protein import TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hereditary spastic paraplegia 13	Pathogenic	rs66468541, rs775037805	RCV000019112 RCV000680223	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HSPD1-related disorder	Likely pathogenic	rs2470123138	RCV003412418	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypomyelinating leukodystrophy 4	Pathogenic; Likely pathogenic	rs72466451, rs2086193735	RCV000019113 RCV001254923	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukodystrophy	Pathogenic	rs72466451	RCV005245481	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT SPASTIC PARAPLEGIA TYPE 13	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary spastic paraplegia	Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKODYSTROPHY, HYPOMYELINATING, 4	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELIZAEUS-MERZBACHER-LIKE DISEASE DUE TO HSPD1 MUTATION	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraplegia	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SPASTIC PARAPLEGIA 13, AUTOSOMAL DOMINANT	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraplegia, autosomal dominant	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA, HEREDITARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (351)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	12140130, 14993140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	21751358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28178129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	1352969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14963017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	16677799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	28319253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	16677799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	29766408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39201760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21473952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	19711212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19772795, 21683641, 7905462, 9705246		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29415987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	18759277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	9754895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	36291095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	10559011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	15120829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	15120829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	15120829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	16677799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16116071, 16218479, 19418313, 19880562, 20609438, 22038107, 22901435, 23192457, 23357787, 24347824, 25395618, 26477505, 26786003, 27712463, 28189968 View all (12 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	1316935, 14643638, 20526808, 23376792, 25904550, 31727095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	1316935, 2194963, 7883993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	14500649, 15529360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	12847694, 1316935, 7883993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10640771, 23705835, 8608642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10692038, 11048656, 17457039, 7632088, 8608642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	30340651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29650991, 31727095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19913588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19913588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10701837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10701837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10021466, 10203577, 21798264, 22901435, 24347824, 25654359, 26078803, 28604836, 29151033, 32196617, 35308005, 7664485, 8099471, 9250400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16116071, 16218479, 19418313, 19880562, 20609438, 22038107, 22901435, 23192457, 23357787, 24347824, 25395618, 26477505, 26786003, 27712463, 28189968 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16116071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	LHGDN	15249499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	8608687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10047432, 12414951, 12421990, 12791317, 16218479, 19197326, 19207939, 19931650, 2476144, 27899808, 28181533, 28321419, 28844827, 29177667, 31280312 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10203577, 11882035, 1979591, 2194963, 33196989, 7913951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	16320351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	8778028	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant spastic paraplegia type 13	Spastic Paraplegia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27864821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	11600199, 15654837, 18336589, 28276957, 28844827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15196263, 15654836, 15654837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	25891376, 29979378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30337218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	23807299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25269047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25454514, 28591216, 30365075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28591216, 30365075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli ulcer	Pubtator	21072233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	35563712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12860287, 15957980, 17048249, 19568603, 27491302, 37694354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17457039	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17048249, 28178129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15810071, 26137588, 33307168, 36291095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18372523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28178129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27460076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31112866	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31222140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23429486, 31477750, 8098058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	12967636		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	12967636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	7901255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	31209364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17202307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18229457, 22882677, 29151033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32739154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	LHGDN	16254226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	25654359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	10680751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	21206505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	18571143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23118872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23118872	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	8666687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondroma	Chordoma	Pubtator	11079732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choreoathetosis	Choreoathetosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	18240224, 28976240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24347824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11162143, 9015387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22140545, 28976240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	37211381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31658770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	1424286, 22297444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28261350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19369584, 31397080, 31788106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17457039, 20164542, 20433702, 23004678, 28347227, 33971488, 36499558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21973086	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23754516, 31209364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	11048656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31112866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18229457, 18320357, 21889313, 30093913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	17052347, 18229457, 39445733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18229457, 18320357, 21889313, 30093913, 30669938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	18229457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	16297172, 18320357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15893396, 16602628, 18229457, 18320357, 21889313, 30093913, 30746790		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	19106391		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cortical Dysplasia	Cortical Dysplasia	BEFREE	14643002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	1424286	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	16618609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12909651, 16000490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27118120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22869467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	18240224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	18240224, 28183315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12421990, 15952088, 18229457, 28591216, 29134442, 29467719, 9790880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12421990, 15952088, 18229457, 28591216, 29134442, 29137485, 29467719, 9790880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28591216, 29867058, 7913951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29134442	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18229457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20067962	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10047432, 12791317, 25157497, 27082999, 28467202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15952088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	29546475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	12515899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	12515899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	31188484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	20138216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	10834984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	7672143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	8098058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36889194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34954697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22487187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	21261714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	33261560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	14663101, 15583145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	16618609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	BEFREE	28398639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genital ulcers	Genital ulcers	BEFREE	10618099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	19109937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28730968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	30899261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29616680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17233837, 27325206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30111643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	10354275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35486633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	8799697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	30333963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	30333963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19197326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	22702715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23754516, 31209364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	28698656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	11839840, 16682546, 17420924, 19006192, 19423133, 31762598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	31589899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Autosomal Dominant Spastic Paraplegia	Spastic paraplegia	BEFREE	11839840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15378696, 19424620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11124034, 30802639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	39445733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29134442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	33196989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29596871, 31321561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31323898		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	9527842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	9527842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	23028910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	23028910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	12374626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	1424286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28194152, 30800066, 31717769		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	28376584, 29035321, 29169891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28194152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	BEFREE	10779593, 18205985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30800066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	1316935, 15993233, 16807696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18229449	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31112866	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	19376672, 9000043, 9683664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	7524076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20694586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24885082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	25957474, 27405012		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukodystrophy	Leukodystrophy	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukodystrophy Hypomyelinating 2	Hypomyelinating leukodystrophy	Pubtator	18571143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Hypomyelinating 4	Hypomyelinating leukodystrophy	Pubtator	18571143, 21717087, 33076433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	18571143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Hypomyelinating, 4	Leukodystrophy	GENOMICS_ENGLAND_DG	11898127, 27604308, 30083362		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukodystrophy, Hypomyelinating, 4	Leukodystrophy	ORPHANET_DG	18571143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukodystrophy, Hypomyelinating, 4	Leukodystrophy	CTD_human_DG	18571143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukodystrophy, Hypomyelinating, 4	Leukodystrophy	UNIPROT_DG	18571143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukodystrophy, Hypomyelinating, 4	Leukodystrophy	BEFREE	19706612, 25957474, 27405012		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukodystrophy, Hypomyelinating, 4	Leukodystrophy	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31222140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12215374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17728021, 29672920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	7526135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	8666687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17728021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	29616680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	24455675, 26859598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19657000, 26700624, 28178129, 37694354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11048656, 8608642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	8608687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16253146, 25207654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31222140, 37661276	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17058790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	17058790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30180869		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19197326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25454514, 28591216, 30365075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	21261714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31112866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28178129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31222140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23429486, 31477750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19369584, 29415987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16705742, 30897525, 31426412, 31673102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15378696, 19424620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25207654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15880780, 16308103, 17467856, 18086682, 19022255, 20351780, 25207654, 26074449, 26672742, 28261350, 28457707, 28525768, 28718351, 28774748, 29177667 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28261350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26672742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21792879, 22872370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27864821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metaphyseal chondrodysplasia Schmid type	Metaphyseal chondrodysplasia	Pubtator	10383388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	30537064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	12374626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30614112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11959456, 18086682, 21717087, 21769504, 26700624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Respiratory Chain Deficiencies	Mitochondrial Respiratory Chain Deficiencies	BEFREE	10714591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	24738046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	10997339, 19950419, 31024869, 8165052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	19950419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucolipidosis Type IV	Mucolipidosis	BEFREE	31317194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	14663101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	22350072, 32155663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	1374907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	1374907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	21429694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	22258649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	12967636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30896796, 31109132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	7901255	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	25157497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	17201177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10931134, 14500649, 15547707, 16725110, 17905417, 18086682, 19197326, 22487187, 22843331, 23055194, 23807299, 23839491, 25207654, 25220060, 28617974, 29287145, 29415987, 31477750, 8098058 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18797883, 30609639, 31963896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22012253, 30609639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	18571143, 21717087, 31444388, 31861692, 32739154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18571143, 23339303, 28586011, 31444388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	18571143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	31444388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	31444388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28178129, 31305682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24084737, 27899808, 29024428, 29467719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24986468	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	39593105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	29024428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27118120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19306954, 25058444, 30224697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30224697, 31582745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24015183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	39593105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23429486, 31477750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23429486, 25265318, 34557266, 37087461, 39593105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31477750	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19369584, 29415987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29415987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24123003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	21429694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30945962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelizaeus-Merzbacher-like disease due to HSPD1 mutation	Pelizaeus-Merzbacher disease	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontal Diseases	Periodontal disease	Pubtator	11882035, 11953387, 16542362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	25058444, 25220060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	11882035, 11953387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11953387, 19109937, 25058444, 28667536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	16542362	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	29293508		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	29293508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	16807696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34480296, 38256230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15120760, 7526135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria, type I	Hyperoxaluria	BEFREE	30635080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16705742, 30897525, 31426412, 31673102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16705742, 19132982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16705742, 23661456, 29682763, 35241511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27864821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17048249, 22140545, 22829758, 28976240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	11985522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	24111596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31112866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28680529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	28196897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	24738046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	24738046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17925998, 19565483, 24111596, 27160252, 28595106, 30415439, 30465159, 31727095, 31802366, 7684683, 8181523, 9082939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19110265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	17588138, 20587186, 25891376		★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	26759119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11048656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	31150542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17373188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	17420924		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Spastic Paraplegia	Spastic Paraplegia	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Spastic paraplegia 13 autosomal dominant	Spastic paraplegia	Pubtator	18571143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 13, autosomal dominant	Spondylometaphyseal dysplasia	ORPHANET_DG	1189812		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraplegia 13, autosomal dominant	Spondylometaphyseal dysplasia	GENOMICS_ENGLAND_DG	11898127, 27604308		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraplegia 13, autosomal dominant	Spondylometaphyseal dysplasia	UNIPROT_DG	11898127		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraplegia 13, autosomal dominant	Spondylometaphyseal dysplasia	BEFREE	18378094, 18571143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraplegia 13, autosomal dominant	Spondylometaphyseal dysplasia	CTD_human_DG	18571143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraplegia 13, autosomal dominant	Spondylometaphyseal dysplasia	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	11898127, 18400758, 21717087, 31444388, 36316435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	11898127, 17420924, 18378094, 18400758, 19423133, 31444388		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic Paraplegia, Hereditary	Spastic paraplegia	LHGDN	11898127		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	23424650, 23705835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28178129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31222140, 33232279, 37661276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25207654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	26810190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15378696, 19424620		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	19203381, 25207654, 26646027, 26810190, 26928021, 27644641, 35635169	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	27604701, 9754895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	18759277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	LHGDN	12965262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	14730689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21441812, 22297444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12942564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19568603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	26078803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	7906697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	31467116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
von Willebrand Disease Type 2	Von willebrand disorder	Pubtator	25365350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HSPD1 (heat shock protein family D (Hsp60) member 1)