HSP90AB1 (heat shock protein 90 alpha family class B member 1)

Gene

• Entrez ID: 3326
• Gene name: Heat shock protein 90 alpha family class B member 1
• Gene symbol: HSP90AB1
• Synonyms (NCBI Gene): D6S182, HSP84, HSP90B, HSPC2, HSPCB
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. This gene encodes the constitutive form of the cytosolic 90 kDa heat-shock pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016366	hsa-miR-193b-3p	Proteomics	21512034
MIRT049288	hsa-miR-92a-3p	CLASH	23622248
MIRT046508	hsa-miR-15b-5p	CLASH	23622248
MIRT044926	hsa-miR-186-5p	CLASH	23622248
MIRT044757	hsa-miR-320a	CLASH	23622248
MIRT041702	hsa-miR-484	CLASH	23622248
MIRT041702	hsa-miR-484	CLASH	23622248
MIRT041164	hsa-miR-181d-5p	CLASH	23622248
MIRT041138	hsa-miR-501-5p	CLASH	23622248
MIRT039893	hsa-miR-615-3p	CLASH	23622248
MIRT039893	hsa-miR-615-3p	CLASH	23622248
MIRT038803	hsa-miR-93-3p	CLASH	23622248
MIRT038803	hsa-miR-93-3p	CLASH	23622248
MIRT038357	hsa-miR-296-3p	CLASH	23622248
MIRT037860	hsa-miR-455-3p	CLASH	23622248
MIRT037004	hsa-miR-877-3p	CLASH	23622248
MIRT037004	hsa-miR-877-3p	CLASH	23622248
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	20371350
MIRT488267	hsa-miR-335-5p	PAR-CLIP	20371350
MIRT499217	hsa-miR-370-3p	PAR-CLIP	20371350
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	20371350
MIRT488266	hsa-miR-626	PAR-CLIP	20371350
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	20371350
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	20371350
MIRT488262	hsa-miR-4489	PAR-CLIP	20371350
MIRT488263	hsa-miR-4283	PAR-CLIP	20371350
MIRT488261	hsa-miR-185-3p	PAR-CLIP	20371350
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT540125	hsa-miR-4731-3p	PAR-CLIP	21572407
MIRT540124	hsa-miR-4801	PAR-CLIP	21572407
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	21572407
MIRT488267	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT540123	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT499217	hsa-miR-370-3p	PAR-CLIP	21572407
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	21572407
MIRT488266	hsa-miR-626	PAR-CLIP	21572407
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	21572407
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	23446348
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	23446348
MIRT488267	hsa-miR-335-5p	PAR-CLIP	23446348
MIRT499217	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT488266	hsa-miR-626	PAR-CLIP	23446348
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	23446348
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	23446348
MIRT488262	hsa-miR-4489	PAR-CLIP	23446348
MIRT488263	hsa-miR-4283	PAR-CLIP	23446348
MIRT488261	hsa-miR-185-3p	PAR-CLIP	23446348
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	24398324
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	24398324
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	24398324
MIRT488267	hsa-miR-335-5p	PAR-CLIP	24398324
MIRT499217	hsa-miR-370-3p	PAR-CLIP	24398324
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	24398324
MIRT488266	hsa-miR-626	PAR-CLIP	24398324
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	24398324
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	24398324
MIRT488262	hsa-miR-4489	PAR-CLIP	24398324
MIRT488263	hsa-miR-4283	PAR-CLIP	24398324
MIRT488261	hsa-miR-185-3p	PAR-CLIP	24398324
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	24398324
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	23592263
MIRT488267	hsa-miR-335-5p	PAR-CLIP	23592263
MIRT488266	hsa-miR-626	PAR-CLIP	23592263
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	23592263
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	23592263
MIRT488262	hsa-miR-4489	PAR-CLIP	23592263
MIRT488263	hsa-miR-4283	PAR-CLIP	23592263
MIRT488261	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT488261	hsa-miR-185-3p	PAR-CLIP	26701625
MIRT488267	hsa-miR-335-5p	PAR-CLIP	26701625
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	26701625
MIRT488263	hsa-miR-4283	PAR-CLIP	26701625
MIRT488262	hsa-miR-4489	PAR-CLIP	26701625
MIRT488266	hsa-miR-626	PAR-CLIP	26701625
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	26701625
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	26701625
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	20371350
MIRT488267	hsa-miR-335-5p	PAR-CLIP	20371350
MIRT499217	hsa-miR-370-3p	PAR-CLIP	20371350
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	20371350
MIRT488266	hsa-miR-626	PAR-CLIP	20371350
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	20371350
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	20371350
MIRT488262	hsa-miR-4489	PAR-CLIP	20371350
MIRT488263	hsa-miR-4283	PAR-CLIP	20371350
MIRT488261	hsa-miR-185-3p	PAR-CLIP	20371350
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT540125	hsa-miR-4731-3p	PAR-CLIP	21572407
MIRT540124	hsa-miR-4801	PAR-CLIP	21572407
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	21572407
MIRT488267	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT540123	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT499217	hsa-miR-370-3p	PAR-CLIP	21572407
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	21572407
MIRT488266	hsa-miR-626	PAR-CLIP	21572407
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	21572407
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	23446348
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	23446348
MIRT488267	hsa-miR-335-5p	PAR-CLIP	23446348
MIRT499217	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT488266	hsa-miR-626	PAR-CLIP	23446348
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	23446348
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	23446348
MIRT488262	hsa-miR-4489	PAR-CLIP	23446348
MIRT488263	hsa-miR-4283	PAR-CLIP	23446348
MIRT488261	hsa-miR-185-3p	PAR-CLIP	23446348
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	24398324
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	24398324
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	24398324
MIRT488267	hsa-miR-335-5p	PAR-CLIP	24398324
MIRT499217	hsa-miR-370-3p	PAR-CLIP	24398324
MIRT499216	hsa-miR-6893-3p	PAR-CLIP	24398324
MIRT488266	hsa-miR-626	PAR-CLIP	24398324
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	24398324
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	24398324
MIRT488262	hsa-miR-4489	PAR-CLIP	24398324
MIRT488263	hsa-miR-4283	PAR-CLIP	24398324
MIRT488261	hsa-miR-185-3p	PAR-CLIP	24398324
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	24398324
MIRT488271	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT488270	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT488269	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT488268	hsa-miR-3675-5p	PAR-CLIP	23592263
MIRT488267	hsa-miR-335-5p	PAR-CLIP	23592263
MIRT488266	hsa-miR-626	PAR-CLIP	23592263
MIRT488265	hsa-miR-6876-3p	PAR-CLIP	23592263
MIRT488264	hsa-miR-6716-5p	PAR-CLIP	23592263
MIRT488262	hsa-miR-4489	PAR-CLIP	23592263
MIRT488263	hsa-miR-4283	PAR-CLIP	23592263
MIRT488261	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT488260	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055874	hsa-miR-3163	CLIP-seq
MIRT1055875	hsa-miR-3185	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055877	hsa-miR-335	CLIP-seq
MIRT1055878	hsa-miR-3646	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055884	hsa-miR-4680-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT1055886	hsa-miR-514	CLIP-seq
MIRT1055887	hsa-miR-514b-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1549642	hsa-miR-153	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT1549643	hsa-miR-448	CLIP-seq
MIRT1549644	hsa-miR-450b-5p	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1549645	hsa-miR-507	CLIP-seq
MIRT1549646	hsa-miR-557	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1549642	hsa-miR-153	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055877	hsa-miR-335	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT2012821	hsa-miR-4457	CLIP-seq
MIRT1549643	hsa-miR-448	CLIP-seq
MIRT1549644	hsa-miR-450b-5p	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055884	hsa-miR-4680-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT2012822	hsa-miR-4768-3p	CLIP-seq
MIRT1549645	hsa-miR-507	CLIP-seq
MIRT1549646	hsa-miR-557	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055874	hsa-miR-3163	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055877	hsa-miR-335	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT2012821	hsa-miR-4457	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT2012822	hsa-miR-4768-3p	CLIP-seq
MIRT1055886	hsa-miR-514	CLIP-seq
MIRT1055887	hsa-miR-514b-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055877	hsa-miR-335	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT1055886	hsa-miR-514	CLIP-seq
MIRT1055887	hsa-miR-514b-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055879	hsa-miR-370	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT2012821	hsa-miR-4457	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055884	hsa-miR-4680-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT2012822	hsa-miR-4768-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq
MIRT1055868	hsa-miR-1226	CLIP-seq
MIRT1055869	hsa-miR-1284	CLIP-seq
MIRT1055870	hsa-miR-1909	CLIP-seq
MIRT1055871	hsa-miR-214	CLIP-seq
MIRT1055872	hsa-miR-300	CLIP-seq
MIRT1055873	hsa-miR-3148	CLIP-seq
MIRT1055876	hsa-miR-3191	CLIP-seq
MIRT1055880	hsa-miR-381	CLIP-seq
MIRT2012819	hsa-miR-421	CLIP-seq
MIRT2012820	hsa-miR-4297	CLIP-seq
MIRT1055881	hsa-miR-4305	CLIP-seq
MIRT2012821	hsa-miR-4457	CLIP-seq
MIRT1055882	hsa-miR-4666-3p	CLIP-seq
MIRT1055883	hsa-miR-4668-5p	CLIP-seq
MIRT1055885	hsa-miR-4704-5p	CLIP-seq
MIRT2012822	hsa-miR-4768-3p	CLIP-seq
MIRT1055888	hsa-miR-624	CLIP-seq
MIRT1055889	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TP53	Repression	15284248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001890	Process	Placenta development	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0005515	Function	Protein binding	IPI	11036079, 14743216, 15358771, 15581363, 15657067, 15870294, 16293251, 16314389, 16330544, 16531226, 16580629, 16698020, 17932509, 17979178, 18239673, 18320024, 18818696, 19375531, 20029029, 20374249, 20618441, 20650008, 21145461, 21170051, 21183720, 21360678, 21730179, 21988832, 220
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IDA	10811660
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	IMP	10543959
GO:0005576	Component	Extracellular region	IDA	20599762
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	18239673
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	10791971, 11785981, 16580629, 18239673, 24880080
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	ISS	17517623
GO:0006986	Process	Response to unfolded protein	NAS	2768249
GO:0007004	Process	Telomere maintenance via telomerase	IDA	10197982
GO:0007004	Process	Telomere maintenance via telomerase	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0016887	Function	ATP hydrolysis activity	TAS
GO:0019062	Process	Virion attachment to host cell	IMP	24098578
GO:0019887	Function	Protein kinase regulator activity	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0019900	Function	Kinase binding	IPI	20353823, 21855797
GO:0019901	Function	Protein kinase binding	IEA
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0030235	Function	Nitric-oxide synthase regulator activity	ISS
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IDA	24613385
GO:0030911	Function	TPR domain binding	ISS
GO:0031072	Function	Heat shock protein binding	IPI	20353823
GO:0031396	Process	Regulation of protein ubiquitination	IDA	16809764
GO:0031396	Process	Regulation of protein ubiquitination	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16207813
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	24613385
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032880	Process	Regulation of protein localization	ISS
GO:0032991	Component	Protein-containing complex	IBA
GO:0032991	Component	Protein-containing complex	IDA	10811660, 23349634
GO:0032991	Component	Protein-containing complex	IEA
GO:0032991	Component	Protein-containing complex	IMP	10543959
GO:0034605	Process	Cellular response to heat	IBA
GO:0034605	Process	Cellular response to heat	IEA
GO:0034751	Component	Aryl hydrocarbon receptor complex	IDA	15581363
GO:0034774	Component	Secretory granule lumen	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042277	Function	Peptide binding	IPI	20599762
GO:0042470	Component	Melanosome	IEA
GO:0042802	Function	Identical protein binding	IPI	21183720, 22939624, 30382094
GO:0042803	Function	Protein homodimerization activity	IDA	10811660
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	16809764
GO:0043008	Function	ATP-dependent protein binding	IPI	10543959, 10811660
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0044183	Function	Protein folding chaperone	IEA
GO:0044183	Function	Protein folding chaperone	ISS	17517623
GO:0044294	Component	Dendritic growth cone	IEA
GO:0044294	Component	Dendritic growth cone	ISS
GO:0044295	Component	Axonal growth cone	IEA
GO:0044295	Component	Axonal growth cone	ISS
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0045597	Process	Positive regulation of cell differentiation	IMP	18239673
GO:0046983	Function	Protein dimerization activity	IDA	7588731
GO:0048156	Function	Tau protein binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0050821	Process	Protein stabilization	IBA
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	10811660
GO:0051131	Process	Chaperone-mediated protein complex assembly	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	22843495
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0070182	Function	DNA polymerase binding	IEA
GO:0070182	Function	DNA polymerase binding	IPI	10197982, 19751963
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0072542	Function	Protein phosphatase activator activity	IDA	26593036
GO:0097435	Process	Supramolecular fiber organization	IMP	24466266
GO:0097718	Function	Disordered domain specific binding	IEA
GO:0097718	Function	Disordered domain specific binding	IPI	11785981, 15713458
GO:0101031	Component	Protein folding chaperone complex	IEA
GO:0101031	Component	Protein folding chaperone complex	IMP	17517623
GO:0120293	Component	Dynein axonemal particle	IEA
GO:0120293	Component	Dynein axonemal particle	ISS
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:0141069	Function	Receptor ligand inhibitor activity	IDA	20599762
GO:1901799	Process	Negative regulation of proteasomal protein catabolic process	IEA
GO:1901799	Process	Negative regulation of proteasomal protein catabolic process	ISS	17517623
GO:1904813	Component	Ficolin-1-rich granule lumen	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905323	Process	Telomerase holoenzyme complex assembly	IDA	10197982
GO:1905323	Process	Telomerase holoenzyme complex assembly	IEA
GO:1990226	Function	Histone methyltransferase binding	IPI	24880080
GO:1990565	Component	HSP90-CDC37 chaperone complex	IDA	21855797
GO:1990565	Component	HSP90-CDC37 chaperone complex	IEA
GO:2000010	Process	Positive regulation of protein localization to cell surface	IDA	23431407

Other IDs

• MIM: 140572
• HGNC: 5258
• e!Ensembl: ENSG00000096384

Protein

• UniProt ID: P08238
• Protein name: Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) (Heat shock protein family C member 3)
• Protein function: Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle linked to its ATPase act
• PDB: 1QZ2, 1UYM, 2L6J, 3FWV, 3NMQ, 3PRY, 3UQ3, 5FWK, 5FWL, 5FWM, 5FWP, 5UC4, 5UCH, 5UCI, 5UCJ, 6N8W, 6N8Y, 7ULJ, 7Z37, 7Z38, 7ZR0, 7ZR5, 7ZR6, 7ZUB, 8EOA, 8EOB, 8GAE, 8GFT, 8QMO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02518	HATPase_c	35 → 189	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain
  PF00183	HSP90	191 → 712	Hsp90 protein	Family

• Sequence:

  MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
  DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
  ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
  VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
  DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
  YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
  FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
  EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
  KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
  LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
  NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
  TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
  EEVD

• Sequence length: 724

Pathways

KEGG:

Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Necroptosis
Antigen processing and presentation
NOD-like receptor signaling pathway
IL-17 signaling pathway
Th17 cell differentiation
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Salmonella infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
Prostate cancer
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Regulation of actin dynamics for phagocytic cup formation
HSP90 chaperone cycle for steroid hormone receptors (SHR)
HSF1 activation
Attenuation phase
HSF1-dependent transactivation
Sema3A PAK dependent Axon repulsion
Uptake and function of diphtheria toxin
Neutrophil degranulation
The NLRP3 inflammasome
The role of GTSE1 in G2/M progression after G2 checkpoint
Aryl hydrocarbon receptor signalling
ESR-mediated signaling
Estrogen-dependent gene expression
Purinergic signaling in leishmaniasis infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30536958		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35008592, 36569892	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27898717, 34177888	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11775547		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	22706881		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22510516, 24880126, 25617865, 31801945		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22510516, 24880126, 25617865, 27527857, 33145341, 8878452	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	37569852	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22929401	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	36375658	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29271183, 31277598, 31659110, 31811111, 37515378	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27959448		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22929401, 25300907, 29298657, 30522463		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33676525	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36375658	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27711126	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	29595698	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	29595698		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29271183	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27756247, 31801945		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27756247, 31949199, 34120619	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	35327643	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	20047716		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29434648		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19494268	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29434648		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24455749, 38034011	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28028152, 30450970		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28028152		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32831056	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24833881	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	19047110		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26108672	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27258564		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37901992	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	7734402		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37092838	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	22510516	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29871907	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	23400887	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29386344		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34580317	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18591256		★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	30536958	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23155442, 29100024		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	31534518		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19514085, 28359326, 30087438		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	34135558	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	23400887	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22929401	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31124601, 37465678	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31124601, 8216691		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	22929401, 30522463		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22929401	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	35572591	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22510516, 24880126, 25617865, 31801945		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22929401, 25300907, 29298657, 30522463		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17566973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11721455, 30305727, 31596953		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26503892, 28360912, 30305727		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29229936	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30836959		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	20047716		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29434648, 31534518		★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	23400887	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	11721455		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	38259468	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	30522463		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	17201177	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10786689, 19514085, 28359326, 30087438, 30522463, 31013298, 31578366, 31801945		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	31141217, 35008592	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31141217		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24511009, 29247830, 30930968		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24455749	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31885746	Stimulate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22510516, 25617865		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22004293	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	15298715, 30936265	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22843495		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10851351	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	1493372		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	29229936	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17566973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34449539	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29386344		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	16948864	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	36375658	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26464709	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30930968		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29768689	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11721455, 30305727, 31596953		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	23661493		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28360912		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	34449539	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22510516	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34784845, 40446016	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	37465678	Associate	★☆☆☆☆ Found in Text Mining only