HSPA9 (heat shock protein family A (Hsp70) member 9)

Gene

• Entrez ID: 3313
• Gene name: Heat shock protein family A (Hsp70) member 9
• Gene symbol: HSPA9
• Synonyms (NCBI Gene): CRP40, CSA, EVPLS, GRP-75, GRP75, HEL-S-124m, HSPA9B, MOT, MOT2, MTHSP75, PBP74, SAAN, SIDBA4
• Chromosome: 5
• Chromosome location: 5q31.2
• Summary: This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cogn

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs772570880	CT>-	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT031608	hsa-miR-16-5p	Proteomics	18668040
MIRT044460	hsa-miR-320a	CLASH	23622248
MIRT042957	hsa-miR-324-3p	CLASH	23622248
MIRT042742	hsa-miR-339-5p	CLASH	23622248
MIRT039907	hsa-miR-615-3p	CLASH	23622248
MIRT039907	hsa-miR-615-3p	CLASH	23622248
MIRT036458	hsa-miR-1226-3p	CLASH	23622248
MIRT214733	hsa-miR-302b-5p	PAR-CLIP	22100165
MIRT214734	hsa-miR-302d-5p	PAR-CLIP	22100165
MIRT214733	hsa-miR-302b-5p	PAR-CLIP	22100165
MIRT214734	hsa-miR-302d-5p	PAR-CLIP	22100165
MIRT737239	hsa-miR-34a-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR, Flow cytometry	32928232
MIRT214733	hsa-miR-302b-5p	PAR-CLIP	22100165
MIRT214734	hsa-miR-302d-5p	PAR-CLIP	22100165
MIRT214733	hsa-miR-302b-5p	PAR-CLIP	22100165
MIRT214734	hsa-miR-302d-5p	PAR-CLIP	22100165
MIRT1056308	hsa-miR-1208	CLIP-seq
MIRT1056309	hsa-miR-1236	CLIP-seq
MIRT1056310	hsa-miR-1237	CLIP-seq
MIRT1056311	hsa-miR-1246	CLIP-seq
MIRT1056312	hsa-miR-1248	CLIP-seq
MIRT1056313	hsa-miR-1255a	CLIP-seq
MIRT1056314	hsa-miR-1255b	CLIP-seq
MIRT1056315	hsa-miR-1273f	CLIP-seq
MIRT1056316	hsa-miR-1301	CLIP-seq
MIRT1056317	hsa-miR-149	CLIP-seq
MIRT1056318	hsa-miR-200b	CLIP-seq
MIRT1056319	hsa-miR-200c	CLIP-seq
MIRT1056320	hsa-miR-205	CLIP-seq
MIRT1056321	hsa-miR-217	CLIP-seq
MIRT1056322	hsa-miR-2355-3p	CLIP-seq
MIRT1056323	hsa-miR-298	CLIP-seq
MIRT1056324	hsa-miR-299-3p	CLIP-seq
MIRT1056325	hsa-miR-3064-5p	CLIP-seq
MIRT1056326	hsa-miR-3154	CLIP-seq
MIRT1056327	hsa-miR-3162-5p	CLIP-seq
MIRT1056328	hsa-miR-34b	CLIP-seq
MIRT1056329	hsa-miR-34c-3p	CLIP-seq
MIRT1056330	hsa-miR-3611	CLIP-seq
MIRT1056331	hsa-miR-3646	CLIP-seq
MIRT1056332	hsa-miR-3647-3p	CLIP-seq
MIRT1056333	hsa-miR-3662	CLIP-seq
MIRT1056334	hsa-miR-3664-3p	CLIP-seq
MIRT1056335	hsa-miR-376c	CLIP-seq
MIRT1056336	hsa-miR-412	CLIP-seq
MIRT1056337	hsa-miR-429	CLIP-seq
MIRT1056338	hsa-miR-4317	CLIP-seq
MIRT1056339	hsa-miR-4418	CLIP-seq
MIRT1056340	hsa-miR-4436b-3p	CLIP-seq
MIRT1056341	hsa-miR-4438	CLIP-seq
MIRT1056342	hsa-miR-4477b	CLIP-seq
MIRT1056343	hsa-miR-4491	CLIP-seq
MIRT1056344	hsa-miR-4499	CLIP-seq
MIRT1056345	hsa-miR-452	CLIP-seq
MIRT1056346	hsa-miR-4633-5p	CLIP-seq
MIRT1056347	hsa-miR-4657	CLIP-seq
MIRT1056348	hsa-miR-4660	CLIP-seq
MIRT1056349	hsa-miR-4661-5p	CLIP-seq
MIRT1056350	hsa-miR-4666-5p	CLIP-seq
MIRT1056351	hsa-miR-4670-3p	CLIP-seq
MIRT1056352	hsa-miR-4676-3p	CLIP-seq
MIRT1056353	hsa-miR-4695-3p	CLIP-seq
MIRT1056354	hsa-miR-4724-3p	CLIP-seq
MIRT1056355	hsa-miR-4728-3p	CLIP-seq
MIRT1056356	hsa-miR-4760-3p	CLIP-seq
MIRT1056357	hsa-miR-4780	CLIP-seq
MIRT1056358	hsa-miR-4781-3p	CLIP-seq
MIRT1056359	hsa-miR-4793-5p	CLIP-seq
MIRT1056360	hsa-miR-4794	CLIP-seq
MIRT1056361	hsa-miR-483-3p	CLIP-seq
MIRT1056362	hsa-miR-5047	CLIP-seq
MIRT1056363	hsa-miR-507	CLIP-seq
MIRT1056364	hsa-miR-509-3-5p	CLIP-seq
MIRT1056365	hsa-miR-509-5p	CLIP-seq
MIRT1056366	hsa-miR-5096	CLIP-seq
MIRT1056367	hsa-miR-513a-3p	CLIP-seq
MIRT1056368	hsa-miR-520d-5p	CLIP-seq
MIRT1056369	hsa-miR-524-5p	CLIP-seq
MIRT1056370	hsa-miR-532-5p	CLIP-seq
MIRT1056371	hsa-miR-544	CLIP-seq
MIRT1056372	hsa-miR-548l	CLIP-seq
MIRT1056373	hsa-miR-548n	CLIP-seq
MIRT1056374	hsa-miR-548u	CLIP-seq
MIRT1056375	hsa-miR-557	CLIP-seq
MIRT1056376	hsa-miR-676	CLIP-seq
MIRT1056377	hsa-miR-767-3p	CLIP-seq
MIRT1056378	hsa-miR-873	CLIP-seq
MIRT1056379	hsa-miR-885-5p	CLIP-seq
MIRT1056329	hsa-miR-34c-3p	CLIP-seq
MIRT1056308	hsa-miR-1208	CLIP-seq
MIRT1056309	hsa-miR-1236	CLIP-seq
MIRT2012935	hsa-miR-1252	CLIP-seq
MIRT2012936	hsa-miR-1265	CLIP-seq
MIRT1056316	hsa-miR-1301	CLIP-seq
MIRT2012937	hsa-miR-1913	CLIP-seq
MIRT2012938	hsa-miR-1972	CLIP-seq
MIRT1056323	hsa-miR-298	CLIP-seq
MIRT1056324	hsa-miR-299-3p	CLIP-seq
MIRT2012939	hsa-miR-3120-3p	CLIP-seq
MIRT1056326	hsa-miR-3154	CLIP-seq
MIRT1056327	hsa-miR-3162-5p	CLIP-seq
MIRT2012940	hsa-miR-3163	CLIP-seq
MIRT2012941	hsa-miR-3189-5p	CLIP-seq
MIRT2012942	hsa-miR-3200-3p	CLIP-seq
MIRT1056328	hsa-miR-34b	CLIP-seq
MIRT1056329	hsa-miR-34c-3p	CLIP-seq
MIRT1056330	hsa-miR-3611	CLIP-seq
MIRT1056331	hsa-miR-3646	CLIP-seq
MIRT1056332	hsa-miR-3647-3p	CLIP-seq
MIRT1056334	hsa-miR-3664-3p	CLIP-seq
MIRT2012943	hsa-miR-3685	CLIP-seq
MIRT2012944	hsa-miR-374a	CLIP-seq
MIRT2012945	hsa-miR-374b	CLIP-seq
MIRT1056335	hsa-miR-376c	CLIP-seq
MIRT2012946	hsa-miR-3922-5p	CLIP-seq
MIRT1056336	hsa-miR-412	CLIP-seq
MIRT2012947	hsa-miR-4291	CLIP-seq
MIRT2012948	hsa-miR-4310	CLIP-seq
MIRT1056340	hsa-miR-4436b-3p	CLIP-seq
MIRT1056341	hsa-miR-4438	CLIP-seq
MIRT1056343	hsa-miR-4491	CLIP-seq
MIRT1056345	hsa-miR-452	CLIP-seq
MIRT1056346	hsa-miR-4633-5p	CLIP-seq
MIRT1056347	hsa-miR-4657	CLIP-seq
MIRT1056348	hsa-miR-4660	CLIP-seq
MIRT1056349	hsa-miR-4661-5p	CLIP-seq
MIRT1056350	hsa-miR-4666-5p	CLIP-seq
MIRT1056351	hsa-miR-4670-3p	CLIP-seq
MIRT1056352	hsa-miR-4676-3p	CLIP-seq
MIRT1056353	hsa-miR-4695-3p	CLIP-seq
MIRT2012949	hsa-miR-4708-3p	CLIP-seq
MIRT2012950	hsa-miR-4712-5p	CLIP-seq
MIRT2012951	hsa-miR-4758-3p	CLIP-seq
MIRT1056356	hsa-miR-4760-3p	CLIP-seq
MIRT2012952	hsa-miR-4777-5p	CLIP-seq
MIRT1056359	hsa-miR-4793-5p	CLIP-seq
MIRT1056361	hsa-miR-483-3p	CLIP-seq
MIRT1056362	hsa-miR-5047	CLIP-seq
MIRT2012953	hsa-miR-5095	CLIP-seq
MIRT1056367	hsa-miR-513a-3p	CLIP-seq
MIRT2012954	hsa-miR-518d-5p	CLIP-seq
MIRT2012955	hsa-miR-519b-5p	CLIP-seq
MIRT2012956	hsa-miR-519c-5p	CLIP-seq
MIRT2012957	hsa-miR-520c-5p	CLIP-seq
MIRT1056368	hsa-miR-520d-5p	CLIP-seq
MIRT1056369	hsa-miR-524-5p	CLIP-seq
MIRT2012958	hsa-miR-526a	CLIP-seq
MIRT1056370	hsa-miR-532-5p	CLIP-seq
MIRT1056371	hsa-miR-544	CLIP-seq
MIRT1056372	hsa-miR-548l	CLIP-seq
MIRT2012959	hsa-miR-548m	CLIP-seq
MIRT1056373	hsa-miR-548n	CLIP-seq
MIRT2012960	hsa-miR-645	CLIP-seq
MIRT1056377	hsa-miR-767-3p	CLIP-seq
MIRT2012961	hsa-miR-770-5p	CLIP-seq
MIRT1056378	hsa-miR-873	CLIP-seq
MIRT1056379	hsa-miR-885-5p	CLIP-seq
MIRT1056308	hsa-miR-1208	CLIP-seq
MIRT1056310	hsa-miR-1237	CLIP-seq
MIRT1056311	hsa-miR-1246	CLIP-seq
MIRT1056312	hsa-miR-1248	CLIP-seq
MIRT2012935	hsa-miR-1252	CLIP-seq
MIRT1056313	hsa-miR-1255a	CLIP-seq
MIRT1056314	hsa-miR-1255b	CLIP-seq
MIRT2245206	hsa-miR-1297	CLIP-seq
MIRT1056316	hsa-miR-1301	CLIP-seq
MIRT1056317	hsa-miR-149	CLIP-seq
MIRT2245207	hsa-miR-183	CLIP-seq
MIRT1056318	hsa-miR-200b	CLIP-seq
MIRT1056319	hsa-miR-200c	CLIP-seq
MIRT1056320	hsa-miR-205	CLIP-seq
MIRT1056321	hsa-miR-217	CLIP-seq
MIRT1056322	hsa-miR-2355-3p	CLIP-seq
MIRT2245208	hsa-miR-26a	CLIP-seq
MIRT2245209	hsa-miR-26b	CLIP-seq
MIRT1056323	hsa-miR-298	CLIP-seq
MIRT1056324	hsa-miR-299-3p	CLIP-seq
MIRT1056325	hsa-miR-3064-5p	CLIP-seq
MIRT2012939	hsa-miR-3120-3p	CLIP-seq
MIRT1056326	hsa-miR-3154	CLIP-seq
MIRT1056327	hsa-miR-3162-5p	CLIP-seq
MIRT1056328	hsa-miR-34b	CLIP-seq
MIRT1056329	hsa-miR-34c-3p	CLIP-seq
MIRT1056330	hsa-miR-3611	CLIP-seq
MIRT1056331	hsa-miR-3646	CLIP-seq
MIRT1056333	hsa-miR-3662	CLIP-seq
MIRT1056335	hsa-miR-376c	CLIP-seq
MIRT2012946	hsa-miR-3922-5p	CLIP-seq
MIRT2245210	hsa-miR-4282	CLIP-seq
MIRT1056337	hsa-miR-429	CLIP-seq
MIRT1056338	hsa-miR-4317	CLIP-seq
MIRT1056339	hsa-miR-4418	CLIP-seq
MIRT1056340	hsa-miR-4436b-3p	CLIP-seq
MIRT1056341	hsa-miR-4438	CLIP-seq
MIRT2245211	hsa-miR-4465	CLIP-seq
MIRT1056342	hsa-miR-4477b	CLIP-seq
MIRT1056343	hsa-miR-4491	CLIP-seq
MIRT1056345	hsa-miR-452	CLIP-seq
MIRT1056346	hsa-miR-4633-5p	CLIP-seq
MIRT1056347	hsa-miR-4657	CLIP-seq
MIRT1056348	hsa-miR-4660	CLIP-seq
MIRT1056349	hsa-miR-4661-5p	CLIP-seq
MIRT1056350	hsa-miR-4666-5p	CLIP-seq
MIRT1056351	hsa-miR-4670-3p	CLIP-seq
MIRT1056352	hsa-miR-4676-3p	CLIP-seq
MIRT1056353	hsa-miR-4695-3p	CLIP-seq
MIRT2245212	hsa-miR-4698	CLIP-seq
MIRT2012949	hsa-miR-4708-3p	CLIP-seq
MIRT2012950	hsa-miR-4712-5p	CLIP-seq
MIRT1056354	hsa-miR-4724-3p	CLIP-seq
MIRT1056358	hsa-miR-4781-3p	CLIP-seq
MIRT1056360	hsa-miR-4794	CLIP-seq
MIRT2245213	hsa-miR-498	CLIP-seq
MIRT1056362	hsa-miR-5047	CLIP-seq
MIRT1056364	hsa-miR-509-3-5p	CLIP-seq
MIRT2012953	hsa-miR-5095	CLIP-seq
MIRT1056365	hsa-miR-509-5p	CLIP-seq
MIRT1056367	hsa-miR-513a-3p	CLIP-seq
MIRT1056368	hsa-miR-520d-5p	CLIP-seq
MIRT1056369	hsa-miR-524-5p	CLIP-seq
MIRT1056370	hsa-miR-532-5p	CLIP-seq
MIRT1056371	hsa-miR-544	CLIP-seq
MIRT1056372	hsa-miR-548l	CLIP-seq
MIRT2012959	hsa-miR-548m	CLIP-seq
MIRT1056373	hsa-miR-548n	CLIP-seq
MIRT2245214	hsa-miR-601	CLIP-seq
MIRT2012960	hsa-miR-645	CLIP-seq
MIRT1056376	hsa-miR-676	CLIP-seq
MIRT2012961	hsa-miR-770-5p	CLIP-seq
MIRT1056379	hsa-miR-885-5p	CLIP-seq
MIRT1056308	hsa-miR-1208	CLIP-seq
MIRT1056323	hsa-miR-298	CLIP-seq
MIRT1056328	hsa-miR-34b	CLIP-seq
MIRT1056340	hsa-miR-4436b-3p	CLIP-seq
MIRT1056346	hsa-miR-4633-5p	CLIP-seq
MIRT1056351	hsa-miR-4670-3p	CLIP-seq
MIRT1056370	hsa-miR-532-5p	CLIP-seq
MIRT1056372	hsa-miR-548l	CLIP-seq
MIRT1056373	hsa-miR-548n	CLIP-seq
MIRT1056308	hsa-miR-1208	CLIP-seq
MIRT2012935	hsa-miR-1252	CLIP-seq
MIRT2548377	hsa-miR-1283	CLIP-seq
MIRT2548378	hsa-miR-129-3p	CLIP-seq
MIRT2245206	hsa-miR-1297	CLIP-seq
MIRT2245207	hsa-miR-183	CLIP-seq
MIRT2012937	hsa-miR-1913	CLIP-seq
MIRT2012938	hsa-miR-1972	CLIP-seq
MIRT2548379	hsa-miR-199a-5p	CLIP-seq
MIRT2548380	hsa-miR-199b-5p	CLIP-seq
MIRT1056318	hsa-miR-200b	CLIP-seq
MIRT1056319	hsa-miR-200c	CLIP-seq
MIRT1056321	hsa-miR-217	CLIP-seq
MIRT2245208	hsa-miR-26a	CLIP-seq
MIRT2245209	hsa-miR-26b	CLIP-seq
MIRT1056323	hsa-miR-298	CLIP-seq
MIRT1056324	hsa-miR-299-3p	CLIP-seq
MIRT2012939	hsa-miR-3120-3p	CLIP-seq
MIRT2548381	hsa-miR-3121-3p	CLIP-seq
MIRT2548382	hsa-miR-3122	CLIP-seq
MIRT2548383	hsa-miR-3152-3p	CLIP-seq
MIRT2548384	hsa-miR-3153	CLIP-seq
MIRT1056326	hsa-miR-3154	CLIP-seq
MIRT1056327	hsa-miR-3162-5p	CLIP-seq
MIRT2012941	hsa-miR-3189-5p	CLIP-seq
MIRT2012942	hsa-miR-3200-3p	CLIP-seq
MIRT2548385	hsa-miR-33a	CLIP-seq
MIRT2548386	hsa-miR-33b	CLIP-seq
MIRT1056328	hsa-miR-34b	CLIP-seq
MIRT1056329	hsa-miR-34c-3p	CLIP-seq
MIRT1056330	hsa-miR-3611	CLIP-seq
MIRT1056331	hsa-miR-3646	CLIP-seq
MIRT2012943	hsa-miR-3685	CLIP-seq
MIRT1056335	hsa-miR-376c	CLIP-seq
MIRT2548387	hsa-miR-3913-5p	CLIP-seq
MIRT2012946	hsa-miR-3922-5p	CLIP-seq
MIRT2548388	hsa-miR-4273	CLIP-seq
MIRT1056337	hsa-miR-429	CLIP-seq
MIRT1056339	hsa-miR-4418	CLIP-seq
MIRT1056340	hsa-miR-4436b-3p	CLIP-seq
MIRT1056341	hsa-miR-4438	CLIP-seq
MIRT2548389	hsa-miR-4446-5p	CLIP-seq
MIRT2548390	hsa-miR-4452	CLIP-seq
MIRT2245211	hsa-miR-4465	CLIP-seq
MIRT1056342	hsa-miR-4477b	CLIP-seq
MIRT1056343	hsa-miR-4491	CLIP-seq
MIRT1056345	hsa-miR-452	CLIP-seq
MIRT2548391	hsa-miR-4528	CLIP-seq
MIRT1056346	hsa-miR-4633-5p	CLIP-seq
MIRT2548392	hsa-miR-4635	CLIP-seq
MIRT1056347	hsa-miR-4657	CLIP-seq
MIRT1056349	hsa-miR-4661-5p	CLIP-seq
MIRT2548393	hsa-miR-4668-5p	CLIP-seq
MIRT1056351	hsa-miR-4670-3p	CLIP-seq
MIRT1056352	hsa-miR-4676-3p	CLIP-seq
MIRT2548394	hsa-miR-4677-5p	CLIP-seq
MIRT1056353	hsa-miR-4695-3p	CLIP-seq
MIRT2012949	hsa-miR-4708-3p	CLIP-seq
MIRT2012950	hsa-miR-4712-5p	CLIP-seq
MIRT2548395	hsa-miR-4718	CLIP-seq
MIRT2548396	hsa-miR-4742-3p	CLIP-seq
MIRT2548397	hsa-miR-4747-5p	CLIP-seq
MIRT2548398	hsa-miR-4755-5p	CLIP-seq
MIRT2012951	hsa-miR-4758-3p	CLIP-seq
MIRT2548399	hsa-miR-4762-5p	CLIP-seq
MIRT2548400	hsa-miR-4766-3p	CLIP-seq
MIRT2012952	hsa-miR-4777-5p	CLIP-seq
MIRT2548401	hsa-miR-486-5p	CLIP-seq
MIRT2245213	hsa-miR-498	CLIP-seq
MIRT1056364	hsa-miR-509-3-5p	CLIP-seq
MIRT2012953	hsa-miR-5095	CLIP-seq
MIRT1056365	hsa-miR-509-5p	CLIP-seq
MIRT1056367	hsa-miR-513a-3p	CLIP-seq
MIRT2012954	hsa-miR-518d-5p	CLIP-seq
MIRT2012955	hsa-miR-519b-5p	CLIP-seq
MIRT2012956	hsa-miR-519c-5p	CLIP-seq
MIRT2012957	hsa-miR-520c-5p	CLIP-seq
MIRT1056368	hsa-miR-520d-5p	CLIP-seq
MIRT1056369	hsa-miR-524-5p	CLIP-seq
MIRT2012958	hsa-miR-526a	CLIP-seq
MIRT1056370	hsa-miR-532-5p	CLIP-seq
MIRT1056372	hsa-miR-548l	CLIP-seq
MIRT2012959	hsa-miR-548m	CLIP-seq
MIRT1056373	hsa-miR-548n	CLIP-seq
MIRT2548402	hsa-miR-548p	CLIP-seq
MIRT2245214	hsa-miR-601	CLIP-seq
MIRT2548403	hsa-miR-633	CLIP-seq
MIRT2548404	hsa-miR-642a	CLIP-seq
MIRT2012960	hsa-miR-645	CLIP-seq
MIRT1056377	hsa-miR-767-3p	CLIP-seq
MIRT2012961	hsa-miR-770-5p	CLIP-seq
MIRT1056379	hsa-miR-885-5p	CLIP-seq
MIRT2548405	hsa-miR-9	CLIP-seq
MIRT1056308	hsa-miR-1208	CLIP-seq
MIRT1056311	hsa-miR-1246	CLIP-seq
MIRT1056313	hsa-miR-1255a	CLIP-seq
MIRT1056314	hsa-miR-1255b	CLIP-seq
MIRT1056315	hsa-miR-1273f	CLIP-seq
MIRT2548377	hsa-miR-1283	CLIP-seq
MIRT2548378	hsa-miR-129-3p	CLIP-seq
MIRT2245206	hsa-miR-1297	CLIP-seq
MIRT2012937	hsa-miR-1913	CLIP-seq
MIRT2012938	hsa-miR-1972	CLIP-seq
MIRT2548379	hsa-miR-199a-5p	CLIP-seq
MIRT2548380	hsa-miR-199b-5p	CLIP-seq
MIRT1056318	hsa-miR-200b	CLIP-seq
MIRT1056319	hsa-miR-200c	CLIP-seq
MIRT1056320	hsa-miR-205	CLIP-seq
MIRT1056321	hsa-miR-217	CLIP-seq
MIRT2245208	hsa-miR-26a	CLIP-seq
MIRT2245209	hsa-miR-26b	CLIP-seq
MIRT1056323	hsa-miR-298	CLIP-seq
MIRT1056324	hsa-miR-299-3p	CLIP-seq
MIRT2012939	hsa-miR-3120-3p	CLIP-seq
MIRT2548381	hsa-miR-3121-3p	CLIP-seq
MIRT2548382	hsa-miR-3122	CLIP-seq
MIRT2548383	hsa-miR-3152-3p	CLIP-seq
MIRT2548384	hsa-miR-3153	CLIP-seq
MIRT1056326	hsa-miR-3154	CLIP-seq
MIRT1056327	hsa-miR-3162-5p	CLIP-seq
MIRT2012941	hsa-miR-3189-5p	CLIP-seq
MIRT2012942	hsa-miR-3200-3p	CLIP-seq
MIRT2548385	hsa-miR-33a	CLIP-seq
MIRT2548386	hsa-miR-33b	CLIP-seq
MIRT1056328	hsa-miR-34b	CLIP-seq
MIRT1056329	hsa-miR-34c-3p	CLIP-seq
MIRT1056330	hsa-miR-3611	CLIP-seq
MIRT1056331	hsa-miR-3646	CLIP-seq
MIRT2012943	hsa-miR-3685	CLIP-seq
MIRT1056335	hsa-miR-376c	CLIP-seq
MIRT2548387	hsa-miR-3913-5p	CLIP-seq
MIRT2548388	hsa-miR-4273	CLIP-seq
MIRT1056337	hsa-miR-429	CLIP-seq
MIRT1056338	hsa-miR-4317	CLIP-seq
MIRT1056339	hsa-miR-4418	CLIP-seq
MIRT1056340	hsa-miR-4436b-3p	CLIP-seq
MIRT1056341	hsa-miR-4438	CLIP-seq
MIRT2548389	hsa-miR-4446-5p	CLIP-seq
MIRT2548390	hsa-miR-4452	CLIP-seq
MIRT2245211	hsa-miR-4465	CLIP-seq
MIRT1056342	hsa-miR-4477b	CLIP-seq
MIRT1056343	hsa-miR-4491	CLIP-seq
MIRT1056345	hsa-miR-452	CLIP-seq
MIRT2548391	hsa-miR-4528	CLIP-seq
MIRT1056346	hsa-miR-4633-5p	CLIP-seq
MIRT2548392	hsa-miR-4635	CLIP-seq
MIRT1056347	hsa-miR-4657	CLIP-seq
MIRT1056349	hsa-miR-4661-5p	CLIP-seq
MIRT2548393	hsa-miR-4668-5p	CLIP-seq
MIRT1056351	hsa-miR-4670-3p	CLIP-seq
MIRT1056352	hsa-miR-4676-3p	CLIP-seq
MIRT2548394	hsa-miR-4677-5p	CLIP-seq
MIRT1056353	hsa-miR-4695-3p	CLIP-seq
MIRT2012950	hsa-miR-4712-5p	CLIP-seq
MIRT2548395	hsa-miR-4718	CLIP-seq
MIRT1056354	hsa-miR-4724-3p	CLIP-seq
MIRT2548396	hsa-miR-4742-3p	CLIP-seq
MIRT2548397	hsa-miR-4747-5p	CLIP-seq
MIRT2548398	hsa-miR-4755-5p	CLIP-seq
MIRT2012951	hsa-miR-4758-3p	CLIP-seq
MIRT2548399	hsa-miR-4762-5p	CLIP-seq
MIRT2548400	hsa-miR-4766-3p	CLIP-seq
MIRT2012952	hsa-miR-4777-5p	CLIP-seq
MIRT2548401	hsa-miR-486-5p	CLIP-seq
MIRT2245213	hsa-miR-498	CLIP-seq
MIRT1056364	hsa-miR-509-3-5p	CLIP-seq
MIRT2012953	hsa-miR-5095	CLIP-seq
MIRT1056365	hsa-miR-509-5p	CLIP-seq
MIRT1056367	hsa-miR-513a-3p	CLIP-seq
MIRT2012954	hsa-miR-518d-5p	CLIP-seq
MIRT2012955	hsa-miR-519b-5p	CLIP-seq
MIRT2012956	hsa-miR-519c-5p	CLIP-seq
MIRT2012957	hsa-miR-520c-5p	CLIP-seq
MIRT1056368	hsa-miR-520d-5p	CLIP-seq
MIRT1056369	hsa-miR-524-5p	CLIP-seq
MIRT2012958	hsa-miR-526a	CLIP-seq
MIRT1056370	hsa-miR-532-5p	CLIP-seq
MIRT1056372	hsa-miR-548l	CLIP-seq
MIRT2012959	hsa-miR-548m	CLIP-seq
MIRT1056373	hsa-miR-548n	CLIP-seq
MIRT2548402	hsa-miR-548p	CLIP-seq
MIRT2245214	hsa-miR-601	CLIP-seq
MIRT2548403	hsa-miR-633	CLIP-seq
MIRT2548404	hsa-miR-642a	CLIP-seq
MIRT2012960	hsa-miR-645	CLIP-seq
MIRT1056377	hsa-miR-767-3p	CLIP-seq
MIRT2012961	hsa-miR-770-5p	CLIP-seq
MIRT1056379	hsa-miR-885-5p	CLIP-seq
MIRT2548405	hsa-miR-9	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001401	Component	SAM complex	HDA	26477565
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	10411904, 15520177, 15657067, 17184779, 20029029, 20153329, 20195357, 20668094, 22340593, 22726440, 23541579, 23940031, 24189400, 24606901, 24625977, 25416956, 26634371, 26702583, 27607350, 28380382, 28514442, 30021884, 31978385, 31980649, 32807793, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	7684501
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	26702583
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	7829505, 16130169
GO:0005743	Component	Mitochondrial inner membrane	NAS	10339406
GO:0005744	Component	TIM23 mitochondrial import inner membrane translocase complex	NAS	10339406
GO:0005759	Component	Mitochondrial matrix	IDA	7865888
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006611	Process	Protein export from nucleus	IEA
GO:0006886	Process	Intracellular protein transport	NAS	10339406
GO:0007007	Process	Inner mitochondrial membrane organization	IC	26477565
GO:0016226	Process	Iron-sulfur cluster assembly	IBA
GO:0016226	Process	Iron-sulfur cluster assembly	IEA
GO:0016226	Process	Iron-sulfur cluster assembly	IMP	26702583
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IDA	18632665, 25615450
GO:0019899	Function	Enzyme binding	IEA
GO:0030218	Process	Erythrocyte differentiation	IMP	21123823
GO:0031072	Function	Heat shock protein binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078, 21753002
GO:0036444	Process	Calcium import into the mitochondrion	ISS
GO:0042026	Process	Protein refolding	IBA
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578
GO:0043065	Process	Positive regulation of apoptotic process	IDA	29907098
GO:0043065	Process	Positive regulation of apoptotic process	IDA	29907098
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0044183	Function	Protein folding chaperone	IBA
GO:0045646	Process	Regulation of erythrocyte differentiation	IMP	26702583
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IMP	21123823
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	TAS	16130169
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0140275	Component	MIB complex	HDA	26477565
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1902037	Process	Negative regulation of hematopoietic stem cell differentiation	IEA
GO:1903707	Process	Negative regulation of hemopoiesis	IEA

Other IDs

• MIM: 600548
• HGNC: 5244
• e!Ensembl: ENSG00000113013

Protein

• UniProt ID: P38646
• Protein name: Stress-70 protein, mitochondrial (EC 3.6.4.10) (75 kDa glucose-regulated protein) (GRP-75) (Heat shock 70 kDa protein 9) (Heat shock protein family A member 9) (Mortalin) (MOT) (Peptide-binding protein 74) (PBP74)
• Protein function: Mitochondrial chaperone that plays a key role in mitochondrial protein import, folding, and assembly. Plays an essential role in the protein quality control system, the correct folding of proteins, the re-folding of misfolded proteins, and the t
• PDB: 3N8E, 4KBO, 6NHK, 6P2U, 6PMT, 9BLS, 9BLT, 9BLU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00012	HSP70	55 → 653	Hsp70 protein	Family

• Sequence:

  MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDL
  GTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYAT
  KRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAEN
  YLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVI
  AVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTK
  DNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIR
  RTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIG
  AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQT
  QVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTG
  REQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFK
  DQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASERE
  GSGSSGTGEQKEDQKEEKQ

• Sequence length: 679

Pathways

KEGG:

RNA degradation
Tuberculosis

Reactome:

Regulation of HSF1-mediated heat shock response
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant sideroblastic anemia	Pathogenic	rs763817505	RCV000209839	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Even-plus syndrome	Pathogenic	rs751478142, rs765368797	RCV000210028 RCV000209966	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEMIA, SIDEROBLASTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC, 4	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE SIDEROBLASTIC ANEMIA	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENTEROCOLITIS, NECROTIZING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HSPA9-related disorder	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIDEROBLASTIC ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	26491070		★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	31369848		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24770931		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	22683628		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	11898854		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30136058		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36121477	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31027376		★☆☆☆☆ Found in Text Mining only
Anemia Sideroblastic	Sideroblastic anemia	Pubtator	26491070, 38360212	Associate	★☆☆☆☆ Found in Text Mining only
ANEMIA, SIDEROBLASTIC, 4	Anemia	GENOMICS_ENGLAND_DG	26491070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC, 4	Anemia	UNIPROT_DG	26491070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC, 4	Anemia	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28412209		★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29292841		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	34637921	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	21850155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive sideroblastic anemia	Sideroblastic Anemia	ORPHANET_DG	26491070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive sideroblastic anemia	Sideroblastic Anemia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brachycephaly	Brachycephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31379979, 31534628		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31379979	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15670812, 25645922, 26955804	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25225353	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26427040		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27374312, 30983127		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27441470		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	30805796		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	23852020	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	23852020	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	28381432		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	8562412		★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	PSYGENET_DG	23182727		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CNS disorder	CNS Disorder	BEFREE	19280369		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	10739753, 11898854, 12483520, 14639525, 14726016, 15211661, 15340056, 16246722, 16751180, 17055654, 17084038, 19329487, 19894250, 21622031, 22032989, 23311583, 23562423, 23622385, 24781187, 27004399, 27507608, 29225035, 29531219, 31546172, 31722399, 9685618		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	26491070	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	15744458, 17084038, 17981804, 20215648, 26173784, 30199453, 30523557, 9312053		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type II	Cockayne Syndrome	BEFREE	15340056		★☆☆☆☆ Found in Text Mining only
CODAS syndrome	CODAS Syndrome	BEFREE	27102849		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23319326, 28791678, 30107089, 31647608		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24023782	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	30368896		★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	28438452		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of kidney	Renal hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27441470, 27998040, 28381432, 29102807, 29940592, 30946471		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
COWCHOCK SYNDROME	Cowchock Syndrome	BEFREE	27102849		★☆☆☆☆ Found in Text Mining only
CRANIOSYNOSTOSIS, TYPE 2	Craniosynostosis	BEFREE	15340056		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16637013		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30805796, 31502469		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31214116		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	23311583		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	20138216		★☆☆☆☆ Found in Text Mining only
Ear Diseases	Ear disease	Pubtator	36052765	Associate	★☆☆☆☆ Found in Text Mining only
Epiphyseal dysplasia	Epiphyseal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21743296	Associate	★☆☆☆☆ Found in Text Mining only
EVEN-PLUS SYNDROME	Even-Plus Syndrome	ORPHANET_DG	10424819, 26598328		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EVEN-PLUS SYNDROME	Even-Plus Syndrome	BEFREE	26598328, 30933555		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EVEN-PLUS SYNDROME	Even-Plus Syndrome	GENOMICS_ENGLAND_DG	26598328		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EVEN-PLUS SYNDROME	Even-Plus Syndrome	UNIPROT_DG	26598328		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EVEN-plus syndrome	Even-Plus Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EVEN-PLUS SYNDROME	Even-Plus Syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EVEN-PLUS SYNDROME	Even-Plus Syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	31027376		★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	HPO_DG			★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	30590615		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	30590615		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	36121477	Associate	★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	29725297		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22683628		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24068912	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	30620873		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27998040, 28381432, 29102807, 29940592, 30946471		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	26702583		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	27988429		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23311583, 27102849		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28096273, 29434920		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	39272138	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31243735, 31369848		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28381432		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18245478		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10733509	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21123823		★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	23311583		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17934217, 21165951, 21233847, 22683628, 24190572, 30628118, 31310900, 31772652		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17934217		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31502469		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21165951, 21233847		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25379943	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31379979, 31534628		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17934217, 21714113		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26427040, 28349826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27374312, 30776464, 30983127		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28674184		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17848953		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23828548		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31027376		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11713576, 17934217, 18056964, 18245478, 19739077, 21165951, 21233847, 22683628, 23319326, 24625977, 24747666, 25012652, 26634371, 27374312, 28165047, 28412209, 28938577, 30057298, 30776464, 31310900, 31490354, 31502469, 31534628		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	25435367, 31027376		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28674184		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	27102849		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23298496	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	26702583		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11959456, 22544056, 25670781, 30662332, 39272138	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	27102849		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36121477	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35853457	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11187902, 15650063, 21123823, 26702583, 28178280		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	28178280	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11187902		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	8562412		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31341899		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17184779	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	CTD_human_DG	18806098		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	11187902, 17934217, 21714113, 22022577, 23828548, 24190572, 25012652, 26427040, 26634371, 28096273, 28674184, 30107089, 31027376, 31772652, 31845320		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	23311583		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22022577, 27791127		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26095919, 31490354		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	27102849		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28349826		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	20100649		★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	BEFREE	26598328		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27374312, 30983127		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36899836	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28674184		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28412209		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31027376		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	16565515		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	16565515, 22544056, 25645922, 30662332, 35258800	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	18219256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	19657588, 20817635, 21640711, 23831374, 24386261, 25645922, 25665531, 26095919, 29307058		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	BEFREE	24386261		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31066084		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	12483520, 24781187, 25645922		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17848953		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17848953	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	20100649		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20100649, 23182727		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23182727		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe Aplastic Anemia	Anemia	BEFREE	29724291		★☆☆☆☆ Found in Text Mining only
Sideroblastic anemia	Sideroblastic Anemia	GENOMICS_ENGLAND_DG	26491070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sideroblastic anemia	Sideroblastic Anemia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sideroblastic anemia	Sideroblastic Anemia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skeletal dysplasia	Skeletal Dysplasia	BEFREE	26598328		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	28381432		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	28300569, 30199453, 30523557		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27998040		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	25904328	Associate	★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	28300569, 28371141, 29187390, 30523557		★☆☆☆☆ Found in Text Mining only
Spondyloepimetaphyseal disorder	Spondyloepimetaphyseal dysplasia	BEFREE	27102849		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23541579		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23828548		★☆☆☆☆ Found in Text Mining only
Synophrys	Synophrys	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31027376		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31027376		★☆☆☆☆ Found in Text Mining only
UV-Sensitive Syndrome	UV-Sensitive Syndrome	BEFREE	19329487		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	CTD_human_DG	21850155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	31100416		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	16315091, 27507608		★☆☆☆☆ Found in Text Mining only