Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3309
Gene name	Heat shock protein family A (Hsp70) member 5
Gene symbol	HSPA5
Synonyms (NCBI Gene)	BIPGRP78HEL-S-89n
Chromosome	9
Chromosome location	9q33.3
Summary	The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. This protein localizes to the lumen of the endoplasmic reticulum (ER) where it operates as a typical HSP70 chaperone involved in the folding and assembly of proteins

690

Show/Hide all (690)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018562	hsa-miR-335-5p	Microarray	18185580
MIRT023362	hsa-miR-122-5p	Other	21750653
MIRT031900	hsa-miR-16-5p	Proteomics	18668040
MIRT038848	hsa-miR-93-3p	CLASH	23622248
MIRT053102	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	23598416
MIRT054632	hsa-miR-30a-5p	Luciferase reporter assayqRT-PCRWestern blot	24612558
MIRT647516	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT647515	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT647514	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT647513	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT647512	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT647511	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT647510	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT647509	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT571185	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT571184	hsa-miR-3130-5p	PAR-CLIP	20371350
MIRT571182	hsa-miR-4482-5p	PAR-CLIP	20371350
MIRT571183	hsa-miR-4773	PAR-CLIP	20371350
MIRT571181	hsa-miR-1180-5p	PAR-CLIP	20371350
MIRT571179	hsa-miR-7114-3p	PAR-CLIP	20371350
MIRT571180	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT571178	hsa-miR-2053	PAR-CLIP	20371350
MIRT493565	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT493564	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT493563	hsa-miR-668-3p	PAR-CLIP	23592263
MIRT493562	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT493561	hsa-miR-5688	PAR-CLIP	23592263
MIRT493560	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT493559	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT493558	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT493557	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT493556	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT493555	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT493554	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT493553	hsa-miR-5582-3p	PAR-CLIP	23592263
MIRT493552	hsa-miR-5579-5p	PAR-CLIP	23592263
MIRT493551	hsa-miR-4729	PAR-CLIP	23592263
MIRT493550	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT493549	hsa-miR-4451	PAR-CLIP	23592263
MIRT493548	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT493547	hsa-miR-584-5p	PAR-CLIP	23592263
MIRT493546	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT731364	hsa-miR-384	Luciferase reporter assay	26864693
MIRT731364	hsa-miR-384	Luciferase reporter assay	26864693
MIRT493562	hsa-miR-495-3p	Luciferase reporter assayqRT-PCR	28363780
MIRT493562	hsa-miR-495-3p	Luciferase reporter assayqRT-PCR	28363780
MIRT053102	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCR	28363780
MIRT053102	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCR	28363780
MIRT493562	hsa-miR-495-3p	Luciferase reporter assayqRT-PCR	28363780
MIRT493562	hsa-miR-495-3p	Luciferase reporter assayqRT-PCR	28363780
MIRT053102	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCR	28363780
MIRT053102	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCR	28363780
MIRT054632	hsa-miR-30a-5p	Western blottingRNA-seqqRT-PCR	33023006
MIRT647516	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT647515	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT647514	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT647513	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT647512	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT647511	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT647510	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT647509	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT571185	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT571184	hsa-miR-3130-5p	PAR-CLIP	20371350
MIRT571182	hsa-miR-4482-5p	PAR-CLIP	20371350
MIRT571183	hsa-miR-4773	PAR-CLIP	20371350
MIRT571181	hsa-miR-1180-5p	PAR-CLIP	20371350
MIRT571179	hsa-miR-7114-3p	PAR-CLIP	20371350
MIRT571180	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT571178	hsa-miR-2053	PAR-CLIP	20371350
MIRT493565	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT493564	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT493563	hsa-miR-668-3p	PAR-CLIP	23592263
MIRT493562	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT493561	hsa-miR-5688	PAR-CLIP	23592263
MIRT493560	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT493559	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT493558	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT493557	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT493556	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT493555	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT493554	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT493553	hsa-miR-5582-3p	PAR-CLIP	23592263
MIRT493552	hsa-miR-5579-5p	PAR-CLIP	23592263
MIRT493551	hsa-miR-4729	PAR-CLIP	23592263
MIRT493550	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT493549	hsa-miR-4451	PAR-CLIP	23592263
MIRT493548	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT493547	hsa-miR-584-5p	PAR-CLIP	23592263
MIRT493546	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT054632	hsa-miR-30a-5p	Luciferase reporter assayWestern blottingqRT-PCR	34717640
MIRT756422	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCR	35715868
MIRT1056161	hsa-miR-1200	CLIP-seq
MIRT1056162	hsa-miR-1273d	CLIP-seq
MIRT1056163	hsa-miR-1273f	CLIP-seq
MIRT1056164	hsa-miR-1289	CLIP-seq
MIRT1056165	hsa-miR-129-5p	CLIP-seq
MIRT1056166	hsa-miR-1304	CLIP-seq
MIRT1056167	hsa-miR-1305	CLIP-seq
MIRT1056168	hsa-miR-1307	CLIP-seq
MIRT1056169	hsa-miR-181a	CLIP-seq
MIRT1056170	hsa-miR-181b	CLIP-seq
MIRT1056171	hsa-miR-181c	CLIP-seq
MIRT1056172	hsa-miR-181d	CLIP-seq
MIRT1056173	hsa-miR-192	CLIP-seq
MIRT1056174	hsa-miR-197	CLIP-seq
MIRT1056175	hsa-miR-199a-3p	CLIP-seq
MIRT1056176	hsa-miR-199b-3p	CLIP-seq
MIRT1056177	hsa-miR-203	CLIP-seq
MIRT1056178	hsa-miR-215	CLIP-seq
MIRT1056179	hsa-miR-3120-3p	CLIP-seq
MIRT1056180	hsa-miR-3129-5p	CLIP-seq
MIRT1056181	hsa-miR-3135b	CLIP-seq
MIRT1056182	hsa-miR-3198	CLIP-seq
MIRT1056183	hsa-miR-329	CLIP-seq
MIRT1056184	hsa-miR-338-5p	CLIP-seq
MIRT1056185	hsa-miR-3529	CLIP-seq
MIRT1056186	hsa-miR-362-3p	CLIP-seq
MIRT1056187	hsa-miR-3646	CLIP-seq
MIRT1056188	hsa-miR-365	CLIP-seq
MIRT1056189	hsa-miR-3650	CLIP-seq
MIRT1056190	hsa-miR-3652	CLIP-seq
MIRT1056191	hsa-miR-3658	CLIP-seq
MIRT1056192	hsa-miR-3675-3p	CLIP-seq
MIRT1056193	hsa-miR-3685	CLIP-seq
MIRT1056194	hsa-miR-3691-3p	CLIP-seq
MIRT1056195	hsa-miR-379	CLIP-seq
MIRT1056196	hsa-miR-3921	CLIP-seq
MIRT1056197	hsa-miR-3926	CLIP-seq
MIRT1056198	hsa-miR-4262	CLIP-seq
MIRT1056199	hsa-miR-4274	CLIP-seq
MIRT1056200	hsa-miR-4275	CLIP-seq
MIRT1056201	hsa-miR-4294	CLIP-seq
MIRT1056202	hsa-miR-4309	CLIP-seq
MIRT1056203	hsa-miR-4324	CLIP-seq
MIRT1056204	hsa-miR-4426	CLIP-seq
MIRT1056205	hsa-miR-4430	CLIP-seq
MIRT1056206	hsa-miR-4482	CLIP-seq
MIRT1056207	hsa-miR-4492	CLIP-seq
MIRT1056208	hsa-miR-4498	CLIP-seq
MIRT1056209	hsa-miR-4519	CLIP-seq
MIRT1056210	hsa-miR-4534	CLIP-seq
MIRT1056211	hsa-miR-4638-5p	CLIP-seq
MIRT1056212	hsa-miR-4639-3p	CLIP-seq
MIRT1056213	hsa-miR-4647	CLIP-seq
MIRT1056214	hsa-miR-4649-3p	CLIP-seq
MIRT1056215	hsa-miR-4653-3p	CLIP-seq
MIRT1056216	hsa-miR-4653-5p	CLIP-seq
MIRT1056217	hsa-miR-4659a-3p	CLIP-seq
MIRT1056218	hsa-miR-4659b-3p	CLIP-seq
MIRT1056219	hsa-miR-4662b	CLIP-seq
MIRT1056220	hsa-miR-4695-3p	CLIP-seq
MIRT1056221	hsa-miR-4699-3p	CLIP-seq
MIRT1056222	hsa-miR-4699-5p	CLIP-seq
MIRT1056223	hsa-miR-4712-5p	CLIP-seq
MIRT1056224	hsa-miR-4713-5p	CLIP-seq
MIRT1056225	hsa-miR-4714-5p	CLIP-seq
MIRT1056226	hsa-miR-4716-5p	CLIP-seq
MIRT1056227	hsa-miR-4726-3p	CLIP-seq
MIRT1056228	hsa-miR-4735-5p	CLIP-seq
MIRT1056229	hsa-miR-4778-3p	CLIP-seq
MIRT1056230	hsa-miR-4781-3p	CLIP-seq
MIRT1056231	hsa-miR-493	CLIP-seq
MIRT1056232	hsa-miR-495	CLIP-seq
MIRT1056233	hsa-miR-5096	CLIP-seq
MIRT1056234	hsa-miR-520d-5p	CLIP-seq
MIRT1056235	hsa-miR-524-5p	CLIP-seq
MIRT1056236	hsa-miR-544b	CLIP-seq
MIRT1056237	hsa-miR-548ae	CLIP-seq
MIRT1056238	hsa-miR-548aj	CLIP-seq
MIRT1056239	hsa-miR-548am	CLIP-seq
MIRT1056240	hsa-miR-548s	CLIP-seq
MIRT1056241	hsa-miR-548x	CLIP-seq
MIRT1056242	hsa-miR-584	CLIP-seq
MIRT1056243	hsa-miR-597	CLIP-seq
MIRT1056244	hsa-miR-635	CLIP-seq
MIRT1056245	hsa-miR-640	CLIP-seq
MIRT1056246	hsa-miR-668	CLIP-seq
MIRT1056247	hsa-miR-762	CLIP-seq
MIRT1056248	hsa-miR-770-5p	CLIP-seq
MIRT1056249	hsa-miR-936	CLIP-seq
MIRT1056250	hsa-miR-942	CLIP-seq
MIRT1056161	hsa-miR-1200	CLIP-seq
MIRT1549647	hsa-miR-1226	CLIP-seq
MIRT1056177	hsa-miR-203	CLIP-seq
MIRT1549648	hsa-miR-29a	CLIP-seq
MIRT1549649	hsa-miR-29b	CLIP-seq
MIRT1549650	hsa-miR-29c	CLIP-seq
MIRT1056184	hsa-miR-338-5p	CLIP-seq
MIRT1056188	hsa-miR-365	CLIP-seq
MIRT1056203	hsa-miR-4324	CLIP-seq
MIRT1056221	hsa-miR-4699-3p	CLIP-seq
MIRT1056223	hsa-miR-4712-5p	CLIP-seq
MIRT1056232	hsa-miR-495	CLIP-seq
MIRT1056236	hsa-miR-544b	CLIP-seq
MIRT1056244	hsa-miR-635	CLIP-seq
MIRT1056248	hsa-miR-770-5p	CLIP-seq
MIRT1056161	hsa-miR-1200	CLIP-seq
MIRT1056200	hsa-miR-4275	CLIP-seq
MIRT1056203	hsa-miR-4324	CLIP-seq
MIRT1056223	hsa-miR-4712-5p	CLIP-seq
MIRT1056236	hsa-miR-544b	CLIP-seq
MIRT1056248	hsa-miR-770-5p	CLIP-seq
MIRT2012905	hsa-miR-106a	CLIP-seq
MIRT2012906	hsa-miR-106b	CLIP-seq
MIRT2012907	hsa-miR-150	CLIP-seq
MIRT2012908	hsa-miR-17	CLIP-seq
MIRT2012909	hsa-miR-20a	CLIP-seq
MIRT2012910	hsa-miR-20b	CLIP-seq
MIRT2012911	hsa-miR-302a	CLIP-seq
MIRT2012912	hsa-miR-302b	CLIP-seq
MIRT2012913	hsa-miR-302c	CLIP-seq
MIRT2012914	hsa-miR-302d	CLIP-seq
MIRT2012915	hsa-miR-302e	CLIP-seq
MIRT1056181	hsa-miR-3135b	CLIP-seq
MIRT2012916	hsa-miR-3190	CLIP-seq
MIRT2012917	hsa-miR-3202	CLIP-seq
MIRT1056184	hsa-miR-338-5p	CLIP-seq
MIRT1056185	hsa-miR-3529	CLIP-seq
MIRT2012918	hsa-miR-3607-5p	CLIP-seq
MIRT2012919	hsa-miR-3617	CLIP-seq
MIRT1056189	hsa-miR-3650	CLIP-seq
MIRT1056190	hsa-miR-3652	CLIP-seq
MIRT1056193	hsa-miR-3685	CLIP-seq
MIRT2012920	hsa-miR-371-3p	CLIP-seq
MIRT2012921	hsa-miR-372	CLIP-seq
MIRT2012922	hsa-miR-373	CLIP-seq
MIRT1056195	hsa-miR-379	CLIP-seq
MIRT1056205	hsa-miR-4430	CLIP-seq
MIRT1056207	hsa-miR-4492	CLIP-seq
MIRT1056208	hsa-miR-4498	CLIP-seq
MIRT2012923	hsa-miR-4533	CLIP-seq
MIRT1056220	hsa-miR-4695-3p	CLIP-seq
MIRT2012924	hsa-miR-4757-5p	CLIP-seq
MIRT1056232	hsa-miR-495	CLIP-seq
MIRT2012925	hsa-miR-519d	CLIP-seq
MIRT2012926	hsa-miR-520a-3p	CLIP-seq
MIRT2012927	hsa-miR-520b	CLIP-seq
MIRT2012928	hsa-miR-520c-3p	CLIP-seq
MIRT2012929	hsa-miR-520d-3p	CLIP-seq
MIRT2012930	hsa-miR-520e	CLIP-seq
MIRT2012931	hsa-miR-520g	CLIP-seq
MIRT2012932	hsa-miR-520h	CLIP-seq
MIRT1056237	hsa-miR-548ae	CLIP-seq
MIRT1056238	hsa-miR-548aj	CLIP-seq
MIRT1056239	hsa-miR-548am	CLIP-seq
MIRT1056241	hsa-miR-548x	CLIP-seq
MIRT1056242	hsa-miR-584	CLIP-seq
MIRT1056243	hsa-miR-597	CLIP-seq
MIRT2012933	hsa-miR-641	CLIP-seq
MIRT1056246	hsa-miR-668	CLIP-seq
MIRT1056247	hsa-miR-762	CLIP-seq
MIRT2012934	hsa-miR-93	CLIP-seq
MIRT1056161	hsa-miR-1200	CLIP-seq
MIRT1056167	hsa-miR-1305	CLIP-seq
MIRT1056169	hsa-miR-181a	CLIP-seq
MIRT1056170	hsa-miR-181b	CLIP-seq
MIRT1056171	hsa-miR-181c	CLIP-seq
MIRT1056172	hsa-miR-181d	CLIP-seq
MIRT2245204	hsa-miR-182	CLIP-seq
MIRT1056174	hsa-miR-197	CLIP-seq
MIRT1056177	hsa-miR-203	CLIP-seq
MIRT1056179	hsa-miR-3120-3p	CLIP-seq
MIRT1056181	hsa-miR-3135b	CLIP-seq
MIRT1056184	hsa-miR-338-5p	CLIP-seq
MIRT1056185	hsa-miR-3529	CLIP-seq
MIRT2012918	hsa-miR-3607-5p	CLIP-seq
MIRT2012919	hsa-miR-3617	CLIP-seq
MIRT1056188	hsa-miR-365	CLIP-seq
MIRT1056190	hsa-miR-3652	CLIP-seq
MIRT1056191	hsa-miR-3658	CLIP-seq
MIRT1056193	hsa-miR-3685	CLIP-seq
MIRT2012920	hsa-miR-371-3p	CLIP-seq
MIRT1056195	hsa-miR-379	CLIP-seq
MIRT1056196	hsa-miR-3921	CLIP-seq
MIRT1056197	hsa-miR-3926	CLIP-seq
MIRT1056198	hsa-miR-4262	CLIP-seq
MIRT1056199	hsa-miR-4274	CLIP-seq
MIRT1056200	hsa-miR-4275	CLIP-seq
MIRT1056203	hsa-miR-4324	CLIP-seq
MIRT1056204	hsa-miR-4426	CLIP-seq
MIRT1056205	hsa-miR-4430	CLIP-seq
MIRT2245205	hsa-miR-4470	CLIP-seq
MIRT1056206	hsa-miR-4482	CLIP-seq
MIRT1056207	hsa-miR-4492	CLIP-seq
MIRT1056208	hsa-miR-4498	CLIP-seq
MIRT1056209	hsa-miR-4519	CLIP-seq
MIRT1056213	hsa-miR-4647	CLIP-seq
MIRT1056214	hsa-miR-4649-3p	CLIP-seq
MIRT1056216	hsa-miR-4653-5p	CLIP-seq
MIRT1056217	hsa-miR-4659a-3p	CLIP-seq
MIRT1056218	hsa-miR-4659b-3p	CLIP-seq
MIRT1056219	hsa-miR-4662b	CLIP-seq
MIRT1056221	hsa-miR-4699-3p	CLIP-seq
MIRT1056222	hsa-miR-4699-5p	CLIP-seq
MIRT1056223	hsa-miR-4712-5p	CLIP-seq
MIRT1056224	hsa-miR-4713-5p	CLIP-seq
MIRT1056225	hsa-miR-4714-5p	CLIP-seq
MIRT1056226	hsa-miR-4716-5p	CLIP-seq
MIRT1056229	hsa-miR-4778-3p	CLIP-seq
MIRT1056230	hsa-miR-4781-3p	CLIP-seq
MIRT1056232	hsa-miR-495	CLIP-seq
MIRT1056233	hsa-miR-5096	CLIP-seq
MIRT1056236	hsa-miR-544b	CLIP-seq
MIRT1056237	hsa-miR-548ae	CLIP-seq
MIRT1056238	hsa-miR-548aj	CLIP-seq
MIRT1056239	hsa-miR-548am	CLIP-seq
MIRT1056240	hsa-miR-548s	CLIP-seq
MIRT1056241	hsa-miR-548x	CLIP-seq
MIRT1056242	hsa-miR-584	CLIP-seq
MIRT1056243	hsa-miR-597	CLIP-seq
MIRT1056244	hsa-miR-635	CLIP-seq
MIRT2012933	hsa-miR-641	CLIP-seq
MIRT1056246	hsa-miR-668	CLIP-seq
MIRT1056247	hsa-miR-762	CLIP-seq
MIRT1056248	hsa-miR-770-5p	CLIP-seq
MIRT1056250	hsa-miR-942	CLIP-seq
MIRT1056161	hsa-miR-1200	CLIP-seq
MIRT1056167	hsa-miR-1305	CLIP-seq
MIRT1056177	hsa-miR-203	CLIP-seq
MIRT1056179	hsa-miR-3120-3p	CLIP-seq
MIRT1056184	hsa-miR-338-5p	CLIP-seq
MIRT1056188	hsa-miR-365	CLIP-seq
MIRT1056199	hsa-miR-4274	CLIP-seq
MIRT1056203	hsa-miR-4324	CLIP-seq
MIRT2389206	hsa-miR-4444	CLIP-seq
MIRT1056209	hsa-miR-4519	CLIP-seq
MIRT2389207	hsa-miR-4532	CLIP-seq
MIRT1056221	hsa-miR-4699-3p	CLIP-seq
MIRT1056223	hsa-miR-4712-5p	CLIP-seq
MIRT2389208	hsa-miR-4765	CLIP-seq
MIRT1056236	hsa-miR-544b	CLIP-seq
MIRT1056244	hsa-miR-635	CLIP-seq
MIRT1056248	hsa-miR-770-5p	CLIP-seq
MIRT1056161	hsa-miR-1200	CLIP-seq
MIRT1056169	hsa-miR-181a	CLIP-seq
MIRT1056170	hsa-miR-181b	CLIP-seq
MIRT1056171	hsa-miR-181c	CLIP-seq
MIRT1056172	hsa-miR-181d	CLIP-seq
MIRT1056193	hsa-miR-3685	CLIP-seq
MIRT1056196	hsa-miR-3921	CLIP-seq
MIRT1056198	hsa-miR-4262	CLIP-seq
MIRT1056200	hsa-miR-4275	CLIP-seq
MIRT1056203	hsa-miR-4324	CLIP-seq
MIRT1056214	hsa-miR-4649-3p	CLIP-seq
MIRT1056216	hsa-miR-4653-5p	CLIP-seq
MIRT1056221	hsa-miR-4699-3p	CLIP-seq
MIRT1056222	hsa-miR-4699-5p	CLIP-seq
MIRT1056223	hsa-miR-4712-5p	CLIP-seq
MIRT1056225	hsa-miR-4714-5p	CLIP-seq
MIRT1056232	hsa-miR-495	CLIP-seq
MIRT1056236	hsa-miR-544b	CLIP-seq
MIRT1056248	hsa-miR-770-5p	CLIP-seq
MIRT2389206	hsa-miR-4444	CLIP-seq
MIRT2389207	hsa-miR-4532	CLIP-seq
MIRT2389208	hsa-miR-4765	CLIP-seq
MIRT2465458	hsa-miR-2682	CLIP-seq
MIRT2465459	hsa-miR-3714	CLIP-seq
MIRT2465460	hsa-miR-4328	CLIP-seq
MIRT2465461	hsa-miR-449c	CLIP-seq
MIRT2465462	hsa-miR-548an	CLIP-seq
MIRT2548271	hsa-miR-105	CLIP-seq
MIRT2548272	hsa-miR-1182	CLIP-seq
MIRT2548273	hsa-miR-1224-3p	CLIP-seq
MIRT2548274	hsa-miR-1245	CLIP-seq
MIRT2548275	hsa-miR-1260	CLIP-seq
MIRT2548276	hsa-miR-1260b	CLIP-seq
MIRT2548277	hsa-miR-1266	CLIP-seq
MIRT1056162	hsa-miR-1273d	CLIP-seq
MIRT1056163	hsa-miR-1273f	CLIP-seq
MIRT2548278	hsa-miR-1280	CLIP-seq
MIRT2548279	hsa-miR-129-3p	CLIP-seq
MIRT2548280	hsa-miR-1301	CLIP-seq
MIRT1056167	hsa-miR-1305	CLIP-seq
MIRT2548281	hsa-miR-142-5p	CLIP-seq
MIRT2548282	hsa-miR-145	CLIP-seq
MIRT2548283	hsa-miR-148a	CLIP-seq
MIRT2548284	hsa-miR-148b	CLIP-seq
MIRT2548285	hsa-miR-152	CLIP-seq
MIRT1056169	hsa-miR-181a	CLIP-seq
MIRT1056170	hsa-miR-181b	CLIP-seq
MIRT1056171	hsa-miR-181c	CLIP-seq
MIRT1056172	hsa-miR-181d	CLIP-seq
MIRT2548286	hsa-miR-1913	CLIP-seq
MIRT2548287	hsa-miR-1976	CLIP-seq
MIRT1056175	hsa-miR-199a-3p	CLIP-seq
MIRT1056176	hsa-miR-199b-3p	CLIP-seq
MIRT2548288	hsa-miR-296-3p	CLIP-seq
MIRT2548289	hsa-miR-30a	CLIP-seq
MIRT2548290	hsa-miR-30b	CLIP-seq
MIRT2548291	hsa-miR-30c	CLIP-seq
MIRT2548292	hsa-miR-30d	CLIP-seq
MIRT2548293	hsa-miR-30e	CLIP-seq
MIRT2548294	hsa-miR-3123	CLIP-seq
MIRT1056180	hsa-miR-3129-5p	CLIP-seq
MIRT2548295	hsa-miR-3135	CLIP-seq
MIRT1056181	hsa-miR-3135b	CLIP-seq
MIRT2548296	hsa-miR-3140-3p	CLIP-seq
MIRT2548297	hsa-miR-3144-3p	CLIP-seq
MIRT2548298	hsa-miR-3147	CLIP-seq
MIRT2548299	hsa-miR-3149	CLIP-seq
MIRT2548300	hsa-miR-3163	CLIP-seq
MIRT2548301	hsa-miR-3168	CLIP-seq
MIRT2548302	hsa-miR-3174	CLIP-seq
MIRT2548303	hsa-miR-3181	CLIP-seq
MIRT2548304	hsa-miR-3184	CLIP-seq
MIRT2548305	hsa-miR-323-5p	CLIP-seq
MIRT2548306	hsa-miR-324-3p	CLIP-seq
MIRT1056183	hsa-miR-329	CLIP-seq
MIRT1056184	hsa-miR-338-5p	CLIP-seq
MIRT2548307	hsa-miR-340	CLIP-seq
MIRT2548308	hsa-miR-346	CLIP-seq
MIRT2548309	hsa-miR-34a	CLIP-seq
MIRT2548310	hsa-miR-34c-5p	CLIP-seq
MIRT2548311	hsa-miR-3591-5p	CLIP-seq
MIRT2012918	hsa-miR-3607-5p	CLIP-seq
MIRT2012919	hsa-miR-3617	CLIP-seq
MIRT1056186	hsa-miR-362-3p	CLIP-seq
MIRT1056187	hsa-miR-3646	CLIP-seq
MIRT1056189	hsa-miR-3650	CLIP-seq
MIRT1056190	hsa-miR-3652	CLIP-seq
MIRT1056191	hsa-miR-3658	CLIP-seq
MIRT1056192	hsa-miR-3675-3p	CLIP-seq
MIRT2548312	hsa-miR-3680	CLIP-seq
MIRT2548313	hsa-miR-3690	CLIP-seq
MIRT1056194	hsa-miR-3691-3p	CLIP-seq
MIRT2012920	hsa-miR-371-3p	CLIP-seq
MIRT2548314	hsa-miR-374c	CLIP-seq
MIRT2548315	hsa-miR-376a	CLIP-seq
MIRT2548316	hsa-miR-376b	CLIP-seq
MIRT2548317	hsa-miR-378	CLIP-seq
MIRT2548318	hsa-miR-378b	CLIP-seq
MIRT2548319	hsa-miR-378c	CLIP-seq
MIRT2548320	hsa-miR-378d	CLIP-seq
MIRT2548321	hsa-miR-378e	CLIP-seq
MIRT2548322	hsa-miR-378f	CLIP-seq
MIRT2548323	hsa-miR-378h	CLIP-seq
MIRT2548324	hsa-miR-378i	CLIP-seq
MIRT2548325	hsa-miR-3919	CLIP-seq
MIRT1056196	hsa-miR-3921	CLIP-seq
MIRT1056197	hsa-miR-3926	CLIP-seq
MIRT2548326	hsa-miR-3944-3p	CLIP-seq
MIRT2548327	hsa-miR-3944-5p	CLIP-seq
MIRT2548328	hsa-miR-422a	CLIP-seq
MIRT2548329	hsa-miR-423-5p	CLIP-seq
MIRT1056198	hsa-miR-4262	CLIP-seq
MIRT1056199	hsa-miR-4274	CLIP-seq
MIRT1056200	hsa-miR-4275	CLIP-seq
MIRT2548330	hsa-miR-4277	CLIP-seq
MIRT2548331	hsa-miR-4279	CLIP-seq
MIRT2548332	hsa-miR-4280	CLIP-seq
MIRT2548333	hsa-miR-4317	CLIP-seq
MIRT2548334	hsa-miR-4330	CLIP-seq
MIRT2548335	hsa-miR-4422	CLIP-seq
MIRT2548336	hsa-miR-4425	CLIP-seq
MIRT1056204	hsa-miR-4426	CLIP-seq
MIRT1056205	hsa-miR-4430	CLIP-seq
MIRT2389206	hsa-miR-4444	CLIP-seq
MIRT2548337	hsa-miR-4450	CLIP-seq
MIRT1056206	hsa-miR-4482	CLIP-seq
MIRT1056207	hsa-miR-4492	CLIP-seq
MIRT1056208	hsa-miR-4498	CLIP-seq
MIRT2548338	hsa-miR-449a	CLIP-seq
MIRT2548339	hsa-miR-449b	CLIP-seq
MIRT2548340	hsa-miR-450b-3p	CLIP-seq
MIRT2548341	hsa-miR-4518	CLIP-seq
MIRT1056209	hsa-miR-4519	CLIP-seq
MIRT2548342	hsa-miR-4527	CLIP-seq
MIRT2389207	hsa-miR-4532	CLIP-seq
MIRT1056213	hsa-miR-4647	CLIP-seq
MIRT1056214	hsa-miR-4649-3p	CLIP-seq
MIRT1056216	hsa-miR-4653-5p	CLIP-seq
MIRT1056217	hsa-miR-4659a-3p	CLIP-seq
MIRT1056218	hsa-miR-4659b-3p	CLIP-seq
MIRT2548343	hsa-miR-4660	CLIP-seq
MIRT2548344	hsa-miR-4661-5p	CLIP-seq
MIRT1056219	hsa-miR-4662b	CLIP-seq
MIRT2548345	hsa-miR-4687-5p	CLIP-seq
MIRT2548346	hsa-miR-4694-5p	CLIP-seq
MIRT1056222	hsa-miR-4699-5p	CLIP-seq
MIRT2548347	hsa-miR-4703-3p	CLIP-seq
MIRT1056223	hsa-miR-4712-5p	CLIP-seq
MIRT2548348	hsa-miR-4713-3p	CLIP-seq
MIRT1056224	hsa-miR-4713-5p	CLIP-seq
MIRT1056225	hsa-miR-4714-5p	CLIP-seq
MIRT2548349	hsa-miR-4722-3p	CLIP-seq
MIRT1056227	hsa-miR-4726-3p	CLIP-seq
MIRT1056228	hsa-miR-4735-5p	CLIP-seq
MIRT2548350	hsa-miR-4750	CLIP-seq
MIRT2548351	hsa-miR-4756-3p	CLIP-seq
MIRT2389208	hsa-miR-4765	CLIP-seq
MIRT2548352	hsa-miR-4775	CLIP-seq
MIRT1056229	hsa-miR-4778-3p	CLIP-seq
MIRT2548353	hsa-miR-4778-5p	CLIP-seq
MIRT2548354	hsa-miR-4786-5p	CLIP-seq
MIRT2548355	hsa-miR-483-3p	CLIP-seq
MIRT1056231	hsa-miR-493	CLIP-seq
MIRT2548356	hsa-miR-5047	CLIP-seq
MIRT2548357	hsa-miR-513a-3p	CLIP-seq
MIRT2548358	hsa-miR-513b	CLIP-seq
MIRT1056234	hsa-miR-520d-5p	CLIP-seq
MIRT1056235	hsa-miR-524-5p	CLIP-seq
MIRT2548359	hsa-miR-539	CLIP-seq
MIRT1056240	hsa-miR-548s	CLIP-seq
MIRT2548360	hsa-miR-561	CLIP-seq
MIRT2548361	hsa-miR-568	CLIP-seq
MIRT2548362	hsa-miR-590-3p	CLIP-seq
MIRT2548363	hsa-miR-619	CLIP-seq
MIRT2548364	hsa-miR-630	CLIP-seq
MIRT2548365	hsa-miR-638	CLIP-seq
MIRT2012933	hsa-miR-641	CLIP-seq
MIRT2548366	hsa-miR-642b	CLIP-seq
MIRT2548367	hsa-miR-646	CLIP-seq
MIRT2548368	hsa-miR-655	CLIP-seq
MIRT2548369	hsa-miR-660	CLIP-seq
MIRT1056247	hsa-miR-762	CLIP-seq
MIRT2548370	hsa-miR-767-3p	CLIP-seq
MIRT2548371	hsa-miR-769-3p	CLIP-seq
MIRT2548372	hsa-miR-769-5p	CLIP-seq
MIRT1056248	hsa-miR-770-5p	CLIP-seq
MIRT2548373	hsa-miR-873	CLIP-seq
MIRT2548374	hsa-miR-875-5p	CLIP-seq
MIRT2548375	hsa-miR-876-3p	CLIP-seq
MIRT2548376	hsa-miR-921	CLIP-seq
MIRT1056249	hsa-miR-936	CLIP-seq
MIRT1056250	hsa-miR-942	CLIP-seq
MIRT2548271	hsa-miR-105	CLIP-seq
MIRT2548272	hsa-miR-1182	CLIP-seq
MIRT2548273	hsa-miR-1224-3p	CLIP-seq
MIRT2548274	hsa-miR-1245	CLIP-seq
MIRT2548275	hsa-miR-1260	CLIP-seq
MIRT2548276	hsa-miR-1260b	CLIP-seq
MIRT2548277	hsa-miR-1266	CLIP-seq
MIRT1056162	hsa-miR-1273d	CLIP-seq
MIRT1056163	hsa-miR-1273f	CLIP-seq
MIRT2548278	hsa-miR-1280	CLIP-seq
MIRT2548279	hsa-miR-129-3p	CLIP-seq
MIRT2548280	hsa-miR-1301	CLIP-seq
MIRT1056167	hsa-miR-1305	CLIP-seq
MIRT2548281	hsa-miR-142-5p	CLIP-seq
MIRT2548282	hsa-miR-145	CLIP-seq
MIRT2548283	hsa-miR-148a	CLIP-seq
MIRT2548284	hsa-miR-148b	CLIP-seq
MIRT2548285	hsa-miR-152	CLIP-seq
MIRT1056169	hsa-miR-181a	CLIP-seq
MIRT1056170	hsa-miR-181b	CLIP-seq
MIRT1056171	hsa-miR-181c	CLIP-seq
MIRT1056172	hsa-miR-181d	CLIP-seq
MIRT2245204	hsa-miR-182	CLIP-seq
MIRT2548286	hsa-miR-1913	CLIP-seq
MIRT1056174	hsa-miR-197	CLIP-seq
MIRT1056175	hsa-miR-199a-3p	CLIP-seq
MIRT1056176	hsa-miR-199b-3p	CLIP-seq
MIRT2548288	hsa-miR-296-3p	CLIP-seq
MIRT2548289	hsa-miR-30a	CLIP-seq
MIRT2548290	hsa-miR-30b	CLIP-seq
MIRT2548291	hsa-miR-30c	CLIP-seq
MIRT2548292	hsa-miR-30d	CLIP-seq
MIRT2548293	hsa-miR-30e	CLIP-seq
MIRT2548294	hsa-miR-3123	CLIP-seq
MIRT2682477	hsa-miR-3127-5p	CLIP-seq
MIRT1056180	hsa-miR-3129-5p	CLIP-seq
MIRT2548295	hsa-miR-3135	CLIP-seq
MIRT2548296	hsa-miR-3140-3p	CLIP-seq
MIRT2548297	hsa-miR-3144-3p	CLIP-seq
MIRT2548298	hsa-miR-3147	CLIP-seq
MIRT2548299	hsa-miR-3149	CLIP-seq
MIRT2682478	hsa-miR-3157-5p	CLIP-seq
MIRT2548300	hsa-miR-3163	CLIP-seq
MIRT2548301	hsa-miR-3168	CLIP-seq
MIRT2548302	hsa-miR-3174	CLIP-seq
MIRT2548303	hsa-miR-3181	CLIP-seq
MIRT2548304	hsa-miR-3184	CLIP-seq
MIRT2548305	hsa-miR-323-5p	CLIP-seq
MIRT2548306	hsa-miR-324-3p	CLIP-seq
MIRT1056183	hsa-miR-329	CLIP-seq
MIRT1056184	hsa-miR-338-5p	CLIP-seq
MIRT2548307	hsa-miR-340	CLIP-seq
MIRT2548308	hsa-miR-346	CLIP-seq
MIRT2548309	hsa-miR-34a	CLIP-seq
MIRT2548310	hsa-miR-34c-5p	CLIP-seq
MIRT2548311	hsa-miR-3591-5p	CLIP-seq
MIRT2012918	hsa-miR-3607-5p	CLIP-seq
MIRT2012919	hsa-miR-3617	CLIP-seq
MIRT1056186	hsa-miR-362-3p	CLIP-seq
MIRT1056187	hsa-miR-3646	CLIP-seq
MIRT1056191	hsa-miR-3658	CLIP-seq
MIRT2548312	hsa-miR-3680	CLIP-seq
MIRT2548313	hsa-miR-3690	CLIP-seq
MIRT1056194	hsa-miR-3691-3p	CLIP-seq
MIRT2548314	hsa-miR-374c	CLIP-seq
MIRT2548315	hsa-miR-376a	CLIP-seq
MIRT2548316	hsa-miR-376b	CLIP-seq
MIRT2548317	hsa-miR-378	CLIP-seq
MIRT2548318	hsa-miR-378b	CLIP-seq
MIRT2548319	hsa-miR-378c	CLIP-seq
MIRT2548320	hsa-miR-378d	CLIP-seq
MIRT2548321	hsa-miR-378e	CLIP-seq
MIRT2548322	hsa-miR-378f	CLIP-seq
MIRT2548323	hsa-miR-378h	CLIP-seq
MIRT2548324	hsa-miR-378i	CLIP-seq
MIRT2548325	hsa-miR-3919	CLIP-seq
MIRT1056196	hsa-miR-3921	CLIP-seq
MIRT2682479	hsa-miR-3925-5p	CLIP-seq
MIRT1056197	hsa-miR-3926	CLIP-seq
MIRT2548326	hsa-miR-3944-3p	CLIP-seq
MIRT2548327	hsa-miR-3944-5p	CLIP-seq
MIRT2548328	hsa-miR-422a	CLIP-seq
MIRT2548329	hsa-miR-423-5p	CLIP-seq
MIRT1056198	hsa-miR-4262	CLIP-seq
MIRT2682480	hsa-miR-4270	CLIP-seq
MIRT1056199	hsa-miR-4274	CLIP-seq
MIRT1056200	hsa-miR-4275	CLIP-seq
MIRT2548330	hsa-miR-4277	CLIP-seq
MIRT2548332	hsa-miR-4280	CLIP-seq
MIRT2548333	hsa-miR-4317	CLIP-seq
MIRT2548334	hsa-miR-4330	CLIP-seq
MIRT2548336	hsa-miR-4425	CLIP-seq
MIRT1056204	hsa-miR-4426	CLIP-seq
MIRT2682481	hsa-miR-4441	CLIP-seq
MIRT2548337	hsa-miR-4450	CLIP-seq
MIRT2245205	hsa-miR-4470	CLIP-seq
MIRT1056206	hsa-miR-4482	CLIP-seq
MIRT2548338	hsa-miR-449a	CLIP-seq
MIRT2548339	hsa-miR-449b	CLIP-seq
MIRT2548340	hsa-miR-450b-3p	CLIP-seq
MIRT2548341	hsa-miR-4518	CLIP-seq
MIRT1056209	hsa-miR-4519	CLIP-seq
MIRT2548342	hsa-miR-4527	CLIP-seq
MIRT1056210	hsa-miR-4534	CLIP-seq
MIRT1056213	hsa-miR-4647	CLIP-seq
MIRT1056214	hsa-miR-4649-3p	CLIP-seq
MIRT1056215	hsa-miR-4653-3p	CLIP-seq
MIRT1056216	hsa-miR-4653-5p	CLIP-seq
MIRT1056217	hsa-miR-4659a-3p	CLIP-seq
MIRT1056218	hsa-miR-4659b-3p	CLIP-seq
MIRT2548343	hsa-miR-4660	CLIP-seq
MIRT2548344	hsa-miR-4661-5p	CLIP-seq
MIRT1056219	hsa-miR-4662b	CLIP-seq
MIRT2682482	hsa-miR-4676-5p	CLIP-seq
MIRT2548345	hsa-miR-4687-5p	CLIP-seq
MIRT2682483	hsa-miR-4691-3p	CLIP-seq
MIRT2548346	hsa-miR-4694-5p	CLIP-seq
MIRT1056222	hsa-miR-4699-5p	CLIP-seq
MIRT2548347	hsa-miR-4703-3p	CLIP-seq
MIRT1056223	hsa-miR-4712-5p	CLIP-seq
MIRT2548348	hsa-miR-4713-3p	CLIP-seq
MIRT1056224	hsa-miR-4713-5p	CLIP-seq
MIRT1056225	hsa-miR-4714-5p	CLIP-seq
MIRT1056226	hsa-miR-4716-5p	CLIP-seq
MIRT1056227	hsa-miR-4726-3p	CLIP-seq
MIRT1056228	hsa-miR-4735-5p	CLIP-seq
MIRT2548350	hsa-miR-4750	CLIP-seq
MIRT2548351	hsa-miR-4756-3p	CLIP-seq
MIRT2548352	hsa-miR-4775	CLIP-seq
MIRT1056229	hsa-miR-4778-3p	CLIP-seq
MIRT2548353	hsa-miR-4778-5p	CLIP-seq
MIRT1056230	hsa-miR-4781-3p	CLIP-seq
MIRT2548354	hsa-miR-4786-5p	CLIP-seq
MIRT2548355	hsa-miR-483-3p	CLIP-seq
MIRT1056231	hsa-miR-493	CLIP-seq
MIRT2548356	hsa-miR-5047	CLIP-seq
MIRT1056233	hsa-miR-5096	CLIP-seq
MIRT2548357	hsa-miR-513a-3p	CLIP-seq
MIRT2548358	hsa-miR-513b	CLIP-seq
MIRT1056234	hsa-miR-520d-5p	CLIP-seq
MIRT1056235	hsa-miR-524-5p	CLIP-seq
MIRT2548359	hsa-miR-539	CLIP-seq
MIRT1056240	hsa-miR-548s	CLIP-seq
MIRT2548360	hsa-miR-561	CLIP-seq
MIRT2548361	hsa-miR-568	CLIP-seq
MIRT2682484	hsa-miR-575	CLIP-seq
MIRT2548362	hsa-miR-590-3p	CLIP-seq
MIRT2548363	hsa-miR-619	CLIP-seq
MIRT2548364	hsa-miR-630	CLIP-seq
MIRT2548365	hsa-miR-638	CLIP-seq
MIRT2012933	hsa-miR-641	CLIP-seq
MIRT2548366	hsa-miR-642b	CLIP-seq
MIRT2548367	hsa-miR-646	CLIP-seq
MIRT2548368	hsa-miR-655	CLIP-seq
MIRT2548369	hsa-miR-660	CLIP-seq
MIRT2548370	hsa-miR-767-3p	CLIP-seq
MIRT2548371	hsa-miR-769-3p	CLIP-seq
MIRT2548372	hsa-miR-769-5p	CLIP-seq
MIRT1056248	hsa-miR-770-5p	CLIP-seq
MIRT2548373	hsa-miR-873	CLIP-seq
MIRT2548374	hsa-miR-875-5p	CLIP-seq
MIRT2548375	hsa-miR-876-3p	CLIP-seq
MIRT2548376	hsa-miR-921	CLIP-seq
MIRT1056249	hsa-miR-936	CLIP-seq
MIRT1056250	hsa-miR-942	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
ATF4	Repression	16205636
ATF6	Unknown	12713871
BRCA1	Repression	18776923
E2F1	Repression	18840615
GTF2I	Activation	19097122;21503958
HDAC1	Repression	19417144
HDAC9	Repression	19417144
NFYA	Unknown	22530004
XBP1	Activation	14718536;20170659
XBP1	Unknown	12713871
YY1	Activation	15899857

Show/Hide all (96)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	16130169
GO:0005515	Function	Protein binding	IPI	11907036, 12356756, 12577067, 12840015, 18064632, 18264092, 18502753, 18923428, 18923430, 19632185, 20335166, 20467437, 20477988, 20936779, 22613557, 22689054, 22735594, 22796945, 23220234, 23349634, 23769672, 23990668, 24189400, 24473200, 25601083, 26496610, 26551274, 27238082, 285
GO:0005524	Function	ATP binding	IDA	26655470
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IMP	11943137
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	22689054
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	22689054
GO:0005783	Component	Endoplasmic reticulum	IDA	16223484
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	IMP	11943137
GO:0005783	Component	Endoplasmic reticulum	TAS	16130169
GO:0005788	Component	Endoplasmic reticulum lumen	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	IDA	21289099
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	11181571
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IDA	15308636
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IEA
GO:0005829	Component	Cytosol	IDA	22689054
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006413	Process	Translational initiation	IDA	16289705
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006983	Process	ER overload response	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IDA	20335166, 23975754
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0016887	Function	ATP hydrolysis activity	ISS
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23921388
GO:0019904	Function	Protein domain specific binding	IPI	12411443
GO:0021589	Process	Cerebellum structural organization	IEA
GO:0021680	Process	Cerebellar Purkinje cell layer development	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	11907036
GO:0030335	Process	Positive regulation of cell migration	IMP	23990668
GO:0030496	Component	Midbody	IDA	15166316
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	TAS	19816510
GO:0031072	Function	Heat shock protein binding	IBA
GO:0031204	Process	Post-translational protein targeting to membrane, translocation	IMP	29719251
GO:0031333	Process	Negative regulation of protein-containing complex assembly	ISS
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	8666824
GO:0032991	Component	Protein-containing complex	IDA	23349634
GO:0034663	Component	Endoplasmic reticulum chaperone complex	IBA
GO:0034663	Component	Endoplasmic reticulum chaperone complex	IDA	18400946
GO:0034663	Component	Endoplasmic reticulum chaperone complex	IEA
GO:0034975	Process	Protein folding in endoplasmic reticulum	TAS	22013210
GO:0034976	Process	Response to endoplasmic reticulum stress	TAS	14685163
GO:0035437	Process	Maintenance of protein localization in endoplasmic reticulum	IMP	23990668
GO:0036498	Process	IRE1-mediated unfolded protein response	IEA
GO:0036499	Process	PERK-mediated unfolded protein response	IDA	25925385, 31023583
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	TAS	19816510
GO:0042026	Process	Protein refolding	IBA
GO:0042149	Process	Cellular response to glucose starvation	IDA	10085239
GO:0042470	Component	Melanosome	IEA
GO:0043022	Function	Ribosome binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10760948, 12665508
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	22689054
GO:0044183	Function	Protein folding chaperone	IBA
GO:0044183	Function	Protein folding chaperone	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	14685163
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	TAS	14685163, 16130169, 22013210
GO:0051087	Function	Protein-folding chaperone binding	TAS	19816510
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0051787	Function	Misfolded protein binding	IDA	18400946
GO:0051787	Function	Misfolded protein binding	IEA
GO:0060904	Process	Regulation of protein folding in endoplasmic reticulum	TAS	19816510
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1903891	Process	Regulation of ATF6-mediated unfolded protein response	TAS	22934019
GO:1903894	Process	Regulation of IRE1-mediated unfolded protein response	TAS	22934019
GO:1903895	Process	Negative regulation of IRE1-mediated unfolded protein response	ISS
GO:1903897	Process	Regulation of PERK-mediated unfolded protein response	TAS	22934019
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IDA	11907036

MIM	HGNC	e!Ensembl
138120	5238	ENSG00000044574

P11021

Protein name

Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin h

Protein function

Endoplasmic reticulum chaperone that plays a key role in protein folding and quality control in the endoplasmic reticulum lumen (PubMed:2294010, PubMed:23769672, PubMed:23990668, PubMed:28332555). Involved in the correct folding of proteins and

PDB

3IUC , 3LDL , 3LDN , 3LDO , 3LDP , 5E84 , 5E85 , 5E86 , 5EVZ , 5EX5 , 5EXW , 5EY4 , 5F0X , 5F1X , 5F2R , 6ASY , 6CZ1 , 6DFM , 6DFO , 6DO2 , 6DWS , 6ZMD , 7N1R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00012	HSP70	30 → 636	Hsp70 protein	Family

Sequence

MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL

Sequence length

654

Interactions

View interactions

	KEGG		Reactome
	Protein export Protein processing in endoplasmic reticulum Antigen processing and presentation Thyroid hormone synthesis Parkinson disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Lipid and atherosclerosis		Regulation of HSF1-mediated heat shock response ATF6 (ATF6-alpha) activates chaperones PERK regulates gene expression IRE1alpha activates chaperones ATF6 (ATF6-alpha) activates chaperone genes Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASBESTOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOPAMINE BETA HYDROXYLASE DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOLOGIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 17	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (385)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21517817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	25248926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18331622, 19277794, 19861963, 22297694, 30032821, 30121368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18331622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30121368, 30297634, 30931255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16182273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	24977433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	29474877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	24924946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28407787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19072283, 25689303, 34153352, 35378534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26327808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29069845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28550415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Dyserythropoietic Congenital	Congenital dyserythropoietic anemia	Pubtator	8639805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	18720263		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26530532, 26939701, 28130223, 28461470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	28186997, 36291095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	27889204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28551635, 28858301, 30568038, 31717752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	24431899, 25228326, 30684743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15077298, 19128512, 24512104, 27618024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	CTD_human_DG	25324550		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthenozoospermia	Asthenozoospermia	BEFREE	30229503, 30590815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	30229503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28192616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28192616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15836927, 17223147, 21112319, 28978127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	28550415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28858301, 30568038, 31717752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32086320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	14717921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	27373828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	36969237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	39237030	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21622563, 28641223, 28748446, 29042970, 29939407, 30426803, 30930218, 31077207, 31579948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16168956, 29843019		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	16168956		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16168956		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	17217928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23085757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	12621026	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	28337259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21329792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	37992682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10424404, 15994954, 18776923, 20473863, 21622563, 23735188, 24002052, 24131405, 24297638, 25194164, 25212833, 25301734, 25454514, 25973748, 26119938 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17440086, 17465192, 19017364, 19674193, 19861963, 20473863, 21622563, 21928251, 23497519, 25973748, 31306849, 31311202, 31416894, 31531187, 31635499 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28287102, 32672418	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	30563499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	10828444, 1382410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	1382410, 20723265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18840615, 23755268, 36162331, 37487081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15810071, 21199322, 21445355, 21779363, 22546345, 22692946, 23973991, 24314144, 24383061, 25225353, 25798051, 25958313, 26327128, 27888630, 28407787 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28402954	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15949590, 17695526, 19087354, 19212831, 20599289, 22088532, 28363780, 28668844, 30931255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23056589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26530532, 34768108, 37696842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29073630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35982901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22495374, 24756776, 25921171, 29291021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31034488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Alcoholic	Cardiomyopathy	Pubtator	30160187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27711126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	30160187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16544732, 28286085, 28562118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36012132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	32086320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	26091066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar Diseases	BEFREE	31236596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	28337259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29774449		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28245171, 29650944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28245171, 29650944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28407787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24141775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24587347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	23852020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	23852020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	22912664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28329734, 29768353, 31180530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31823704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21779363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19072283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33299870, 35185383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10198218, 16182273, 22529978, 22898250, 22945507, 23759331, 24314144, 25277658, 25431258, 25618598, 26225471, 28551635, 29879413, 31129054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	16182273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21382870, 22945507, 23759331, 23818965, 24333163, 25519021, 27034162, 27634156, 28870916, 29805687, 30741544, 31243264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21382870, 22529978, 22898250, 23818965, 24314144, 25277658, 25431258, 25519021, 25618598, 27034162, 29483217, 31199053, 31243264, 33023006, 36380064, 37658050 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38114593	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	22425662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	26091066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26055788, 31471408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23428538, 29073630, 30653515, 31342628, 31669222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	2452042, 28304291, 28903365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24373961, 28304291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28304291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	39881366	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31557250, 33822017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis laxa, x-linked	Cutis Laxa, X-Linked	BEFREE	9467005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30550797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18720263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20626852, 29327364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	24703171	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	31718076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22403299, 24985580, 28630460, 30407281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22403299, 23307819, 24985580, 28630460, 30407281, 31545290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22403299	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25466870, 32965004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22699564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30348823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23402331, 23638076, 25511473, 32851081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34414940	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22079479, 25204978, 26611106, 30348823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17906960, 22155243, 23402331, 25511473, 26005757, 28630460, 29257218, 31717752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	27159390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	18776125, 34414940, 39273100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	18776125, 28115289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28950253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	28950253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	23472144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	28195407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	24111704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21622563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22543280, 23200913, 23280503, 24526410, 29416645, 31783195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	27771165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23200913, 23280503, 27771165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	29272280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24194940	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28407361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33650665, 36582172	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial encephalopathy with neuroserpin inclusion bodies	Encephalopathy With Neuroserpin Inclusion Bodies	BEFREE	26733586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24141775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	34768836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	37248472	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28951310, 31108350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	24938168, 7712471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	26327128	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	26327128		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29563863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	20103053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	21382870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	23108377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	30906929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	20664690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20664690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17942911, 23284962, 26419972, 27815359, 29407769, 29615633, 29718569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18403493	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19549899, 26108672, 30649790, 31534165, 37212470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17942911, 22745010, 23284962, 26419972, 27815359, 29407769, 29615633, 29718569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17942911, 21329792, 23284962, 28344016, 31519193, 31730912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18403493, 18708359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18403493, 18708359, 23280445, 23335989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	40234584	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	19107326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	27166157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	27566407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33613444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	28337259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	18790759, 24201869, 29260979, 29323121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	29323121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26055788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	26055788	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	CTD_human_DG	23777986		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29907328		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematopoietic Neoplasms	Hematopoietic Neoplasms	CTD_human_DG	23777986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	32128578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	31279900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21779363, 31027244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	32482939	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27129228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	27129228	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	28186997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	23703028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21062387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	22425662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30026731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19103594, 28627684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	9576870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	10906332, 37248472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	34769349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemic Nephropathy, Familial Juvenile 1	Hyperuricemic Nephropathy	BEFREE	21978600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	23755268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18694499, 35301432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30739528, 31769345	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29074489, 31738079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28286085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30301140, 30443201, 31563103		★★★★★ ★☆☆☆☆ Found in Text Mining only
INCLUSION BODY MYOPATHY WITH EARLY-ONSET PAGET DISEASE AND FRONTOTEMPORAL DEMENTIA	Inclusion Body Myopathy With Paget Disease And Frontotemporal Dementia	BEFREE	30654731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	39237030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22028783	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36814575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	30232220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	29899701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	16211239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28115289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	28115289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28539339, 29915879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	22803570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	31236596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	30647798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	30647798	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19277794, 26011749, 29205207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22215138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20858700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	22803570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoid congenital adrenal hyperplasia	Congenital lipoid adrenal hyperplasia	Pubtator	1661294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11678611, 12713871, 19533686, 19830497, 20087778, 21347788, 21371443, 21445355, 21516372, 21779363, 21947694, 22546345, 22581315, 22851173, 23416888 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16400691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284, 29698666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21779363, 28186997, 28402954, 31279900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	21779363, 28186997, 28402954, 33291080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	30594786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30594786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22581315, 22851173, 24394318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32086320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15949590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17695526, 18694499, 33115703, 36521248, 38203736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33767597	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25516752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25516752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25516752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25516752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20497865	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24766948, 25480418, 26409455, 30290833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28854502	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28983626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26253462, 29205207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	19107326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31727394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17942911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	18790759, 24201869, 29260979, 29323121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	21106982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15994954, 18776923, 19861963, 20473863, 21622563, 24002052, 24131405, 25194164, 25212833, 25301734, 25454514, 25973748, 26119938, 27130664, 28287102 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22543280, 23200913, 24526410, 29416645, 31783195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	8528482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24141775, 24568465, 28407787, 28601093, 29465313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15949590, 17695526, 19087354, 19212831, 20599289, 22088532, 28363780, 28668844, 30931255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24756776, 25921171, 29291021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25218495, 25333575, 26530532, 29137221, 30755605, 31456633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17062670, 17145889, 21056970, 21125667, 22689054, 22851173, 23049684, 23272152, 23922175, 24962028, 25338653, 25669168, 25720493, 28394345, 28739722, 28978049, 30563499 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23108377, 24602846, 26045166, 28854502, 29069845, 29616092, 29805694, 30341283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	17431003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12713871, 15212714, 16472112, 17373820, 19417154, 19830497, 20087778, 20178102, 20544786, 20979610, 21112319, 21347788, 21467168, 21516372, 21947694 View all (57 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28245171, 29650944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10198218, 16182273, 22529978, 22898250, 22945507, 23759331, 24314144, 25277658, 25431258, 25618598, 26225471, 28551635, 29879413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10752676, 25973748, 29206917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	21106982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	16282978, 24473200, 25473114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28038712		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18842681, 22495669, 22851173, 25480418, 27238082, 27502501, 28393217		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18842681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20368692, 20546536, 21597391, 23056502, 25016296, 27502501, 29734677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19838160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29744892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21633399	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23298496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21633399, 28521868, 31717752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	20546536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30563499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19331169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	28915587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	36136088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20497865, 24766948, 34318593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30563499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Epiphyseal Dysplasia	Multiple Epiphyseal Dysplasia	BEFREE	30543055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19713465, 25605012, 26025442, 27029491, 28506771, 30563499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23667612, 25605012, 25637055, 30563499, 32937189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18344911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32640422	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34725263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	24882382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CTD_human_DG	23777986		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	30723919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	25450231		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	28551635, 29958740, 30416776, 30678084		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	2452042, 28903365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	24882382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	26091066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	26351848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	24882382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	37094222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	14695312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17184779, 30015969, 30413914, 31769345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17184779, 26409455, 28216622, 30015969, 31769345, 35342334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	39881366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10752676, 15212714, 15514946, 15949590, 15994954, 16205636, 16472112, 17062670, 17440086, 17440835, 18331622, 18790759, 19277794, 19386345, 19417154 View all (72 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10587643, 15514946, 17223147, 19386345, 28054532, 28681934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	15514946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28054532	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28054532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24512104, 25466870, 25689303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	20176102, 25405877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	28679661, 31236596, 31568704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	17761833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	20473581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21940774, 22297694, 24498395, 25081541, 27815359, 28363780, 29048640, 30184615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28951310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	31060051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22837305, 27506747, 27634226, 28768569, 29261404, 29716941, 30018241, 31717752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	25403445, 27481183, 32192153	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	26655953		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oculocutaneous albinism type 1	Oculocutaneous albinism	BEFREE	15677452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28645527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	29232380, 30414263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	29232380, 30414263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19546472	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20626852, 29292760, 34769349, 38090564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	7721766, 8349698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31639651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	26091066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15212714, 27486760, 28947141, 29386905, 30816440, 31534554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30816440, 33291071, 36438897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	25921171		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22495374, 24756776, 25921171, 29291021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25921171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27233943	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	25794856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25218495, 25333575, 26530532, 29137221, 30755605, 31456633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26530532, 26939701, 28130223, 31456633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18192872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	30755605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19809193, 25333575, 26530532, 31358620, 37696842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34768108, 36162331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	25077966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29368272, 31332712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18343577, 25863526, 31100053, 31333410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	32042069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	32571297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28497987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28521868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	28071725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	31236596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	31653009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	30096296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	28497987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17062670, 17145889, 21056970, 21125667, 22689054, 22851173, 23049684, 23272152, 23922175, 24962028, 25338653, 25669168, 25720493, 28394345, 28739722, 28978049, 30563499 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	35075122	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15908432, 16543232, 20368692, 21056970, 21364676, 23049684, 23272152, 23922175, 25669168, 26604689, 30563499, 39967318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16543232, 17062670, 17640713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	8639775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	19282840, 21221615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	23400395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36029373	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24111704, 32086320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28464871	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	25687871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23428538, 31669222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	34004362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	27587023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24431899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Riboflavin Deficiency	Riboflavin deficiency	Pubtator	36014863	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	23400395	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31314904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	19087354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	22530004		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar Ataxia 17	Spinocerebellar ataxia	Pubtator	22530004	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	CTD_human_DG	24413982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar Degeneration	Spinocerebellar Degeneration	LHGDN	16282978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19282840, 22297694, 30032821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25976624, 28228658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20497865, 24766948, 33194991, 34580365, 35419461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24964091	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	30414263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20979610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24141775, 31324878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23108377, 24602846, 26045166, 28854502, 29069845, 29616092, 29805694, 30341283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18268478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21382870, 24260584, 24404153, 28854502, 33982777, 35816252, 36838713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29592873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	19128512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	28550415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17431003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	17431003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36059163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25212833, 29178343, 29484998, 31452065, 31745967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34935899, 37386138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	30723919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	29233047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36982218	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	30426803	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	22438966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15270080	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29650944, 33228592, 35104170, 36264610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HSPA5 (heat shock protein family A (Hsp70) member 5)