Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3308
Gene name	Heat shock protein family A (Hsp70) member 4
Gene symbol	HSPA4
Synonyms (NCBI Gene)	APG-2HEL-S-5aHS24/P52HSPH2RYhsp70hsp70RY
Chromosome	5
Chromosome location	5q31.1

407

Show/Hide all (407)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003977	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003977	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003977	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003977	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003977	hsa-miR-1-3p	Review	19815577
MIRT007050	hsa-miR-30c-5p	Luciferase reporter assayqRT-PCR	22842562
MIRT030164	hsa-miR-26b-5p	Microarray	19088304
MIRT048125	hsa-miR-197-3p	CLASH	23622248
MIRT048037	hsa-miR-148a-3p	CLASH	23622248
MIRT047525	hsa-miR-10a-5p	CLASH	23622248
MIRT044647	hsa-miR-320a	CLASH	23622248
MIRT039721	hsa-miR-615-3p	CLASH	23622248
MIRT036559	hsa-miR-942-5p	CLASH	23622248
MIRT714498	hsa-miR-141-3p	HITS-CLIP	19536157
MIRT714497	hsa-miR-200a-3p	HITS-CLIP	19536157
MIRT714496	hsa-miR-216b-3p	HITS-CLIP	19536157
MIRT714495	hsa-miR-4742-5p	HITS-CLIP	19536157
MIRT714494	hsa-miR-4269	HITS-CLIP	19536157
MIRT714493	hsa-miR-6715b-5p	HITS-CLIP	19536157
MIRT714492	hsa-miR-4514	HITS-CLIP	19536157
MIRT714491	hsa-miR-4692	HITS-CLIP	19536157
MIRT714490	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT714489	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT714488	hsa-miR-593-5p	HITS-CLIP	19536157
MIRT714487	hsa-miR-302c-5p	HITS-CLIP	19536157
MIRT611484	hsa-miR-8485	HITS-CLIP	23313552
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT611480	hsa-miR-4286	HITS-CLIP	23313552
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	23313552
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23313552
MIRT611484	hsa-miR-8485	HITS-CLIP	23313552
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT611480	hsa-miR-4286	HITS-CLIP	23313552
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	23313552
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23313552
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT564013	hsa-miR-3653-3p	HITS-CLIP	23824327
MIRT564012	hsa-miR-3658	HITS-CLIP	23824327
MIRT564011	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	PAR-CLIP	20371350
MIRT564014	hsa-miR-5680	PAR-CLIP	20371350
MIRT564013	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT564012	hsa-miR-3658	PAR-CLIP	20371350
MIRT564011	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT459527	hsa-miR-4517	PAR-CLIP	23592263
MIRT459526	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT459525	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT459524	hsa-miR-6854-5p	PAR-CLIP	23592263
MIRT459523	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT459522	hsa-miR-3185	PAR-CLIP	23592263
MIRT459521	hsa-miR-3928-5p	PAR-CLIP	23592263
MIRT459520	hsa-miR-6806-3p	PAR-CLIP	23592263
MIRT459519	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT459517	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT459518	hsa-miR-4710	PAR-CLIP	23592263
MIRT731408	hsa-let-7c-5p	Luciferase reporter assay	26923191
MIRT731408	hsa-let-7c-5p	Luciferase reporter assay	26923191
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	27418678
MIRT611483	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT611483	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT611483	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT611483	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	27418678
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	27418678
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	27418678
MIRT611482	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT611482	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT611482	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT611482	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT611480	hsa-miR-4286	HITS-CLIP	27418678
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	27418678
MIRT611484	hsa-miR-8485	HITS-CLIP	27418678
MIRT611484	hsa-miR-8485	HITS-CLIP	27418678
MIRT611484	hsa-miR-8485	HITS-CLIP	27418678
MIRT611484	hsa-miR-8485	HITS-CLIP	27418678
MIRT714498	hsa-miR-141-3p	HITS-CLIP	19536157
MIRT714497	hsa-miR-200a-3p	HITS-CLIP	19536157
MIRT714496	hsa-miR-216b-3p	HITS-CLIP	19536157
MIRT714495	hsa-miR-4742-5p	HITS-CLIP	19536157
MIRT714494	hsa-miR-4269	HITS-CLIP	19536157
MIRT714493	hsa-miR-6715b-5p	HITS-CLIP	19536157
MIRT714492	hsa-miR-4514	HITS-CLIP	19536157
MIRT714491	hsa-miR-4692	HITS-CLIP	19536157
MIRT714490	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT714489	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT714488	hsa-miR-593-5p	HITS-CLIP	19536157
MIRT714487	hsa-miR-302c-5p	HITS-CLIP	19536157
MIRT611484	hsa-miR-8485	HITS-CLIP	23313552
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT611480	hsa-miR-4286	HITS-CLIP	23313552
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	23313552
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23313552
MIRT611484	hsa-miR-8485	HITS-CLIP	23313552
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT611480	hsa-miR-4286	HITS-CLIP	23313552
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	23313552
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23313552
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT672260	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	HITS-CLIP	23824327
MIRT564013	hsa-miR-3653-3p	HITS-CLIP	23824327
MIRT564012	hsa-miR-3658	HITS-CLIP	23824327
MIRT564011	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT611484	hsa-miR-8485	HITS-CLIP	23824327
MIRT611483	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611482	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611481	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT611480	hsa-miR-4286	HITS-CLIP	23824327
MIRT611479	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT564015	hsa-miR-4282	PAR-CLIP	20371350
MIRT564014	hsa-miR-5680	PAR-CLIP	20371350
MIRT564013	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT564012	hsa-miR-3658	PAR-CLIP	20371350
MIRT564011	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT459527	hsa-miR-4517	PAR-CLIP	23592263
MIRT459526	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT459525	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT459524	hsa-miR-6854-5p	PAR-CLIP	23592263
MIRT459523	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT459522	hsa-miR-3185	PAR-CLIP	23592263
MIRT459521	hsa-miR-3928-5p	PAR-CLIP	23592263
MIRT459520	hsa-miR-6806-3p	PAR-CLIP	23592263
MIRT459519	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT459517	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT459518	hsa-miR-4710	PAR-CLIP	23592263
MIRT2012901	hsa-miR-4422	CLIP-seq
MIRT2012902	hsa-miR-633	CLIP-seq
MIRT2245192	hsa-miR-1976	CLIP-seq
MIRT2245193	hsa-miR-2053	CLIP-seq
MIRT2245194	hsa-miR-224	CLIP-seq
MIRT2245195	hsa-miR-3145-3p	CLIP-seq
MIRT2245196	hsa-miR-3614-5p	CLIP-seq
MIRT2245197	hsa-miR-375	CLIP-seq
MIRT2245198	hsa-miR-4326	CLIP-seq
MIRT2245199	hsa-miR-4659a-5p	CLIP-seq
MIRT2245200	hsa-miR-4659b-5p	CLIP-seq
MIRT2245201	hsa-miR-4722-3p	CLIP-seq
MIRT2245202	hsa-miR-4769-3p	CLIP-seq
MIRT2245203	hsa-miR-569	CLIP-seq
MIRT2245199	hsa-miR-4659a-5p	CLIP-seq
MIRT2245200	hsa-miR-4659b-5p	CLIP-seq
MIRT2451436	hsa-miR-4687-5p	CLIP-seq
MIRT2451437	hsa-miR-766	CLIP-seq
MIRT2245199	hsa-miR-4659a-5p	CLIP-seq
MIRT2245200	hsa-miR-4659b-5p	CLIP-seq
MIRT2451436	hsa-miR-4687-5p	CLIP-seq
MIRT2548243	hsa-miR-4719	CLIP-seq
MIRT2451437	hsa-miR-766	CLIP-seq
MIRT2245199	hsa-miR-4659a-5p	CLIP-seq
MIRT2245200	hsa-miR-4659b-5p	CLIP-seq
MIRT2451436	hsa-miR-4687-5p	CLIP-seq
MIRT2548243	hsa-miR-4719	CLIP-seq
MIRT2451437	hsa-miR-766	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
CEBPA	Activation	2247079
CREG1	Repression	9710587
HSF1	Activation	12813038;23349863;8114740;8455624
HSF1	Unknown	1508207;15777846;16554822;22940245;23264262
HSF2	Activation	12813038;8114740
HSF2	Unknown	1508207
MYC	Unknown	1562593
SIRT1	Unknown	23349863
STAT3	Activation	19754877

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000774	Function	Adenyl-nucleotide exchange factor activity	IBA
GO:0005515	Function	Protein binding	IPI	20029029, 22990239, 24658140, 25416956, 29568061, 30021884, 31980649, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	NAS	8335910
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	21231916
GO:0006457	Process	Protein folding	IBA
GO:0006986	Process	Response to unfolded protein	NAS	8335910
GO:0030150	Process	Protein import into mitochondrial matrix	IDA	15644312
GO:0043226	Component	Organelle	IEA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	15644312
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070062	Component	Extracellular exosome	IDA	21276792
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA

MIM	HGNC	e!Ensembl
601113	5237	ENSG00000170606

P34932

Protein name

Heat shock 70 kDa protein 4 (HSP70RY) (Heat shock 70-related protein APG-2) (Heat shock protein family H member 2)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00012	HSP70	3 → 607	Hsp70 protein	Family
PF00012	HSP70	586 → 691	Hsp70 protein	Family

Sequence

MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNA
KNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAM
LLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALA
YGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVL
VNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGT
MNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGK
ELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKV
KVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPA
ENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIEN
EGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLY
EDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKE
DQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCS
PIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID

Sequence length

840

Interactions

View interactions

	KEGG		Reactome
	Tight junction Antigen processing and presentation Lipid and atherosclerosis		Regulation of HSF1-mediated heat shock response

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHAGAS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (503)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
5q-syndrome	5q-syndrome	BEFREE	26491070		★★★★★ ★☆☆☆☆ Found in Text Mining only
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	21242666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	21849784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	2796986, 8198534, 9738016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Inflammatory Demyelinating Polyneuropathy	Inflammatory Demyelinating Polyneuropathy	BEFREE	29904402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30851439, 30947809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	7860358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	8669833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30746368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24481441, 31370342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	22914605, 23196783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28810585, 30656694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31499034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	7961560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21403392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	26502815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	33395399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies	Amyloid neuropathy	Pubtator	24828240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27531960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	12843283, 22353756, 26936937, 28716533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	27570075, 32687490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	12213295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25450359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sideroblastic	Sideroblastic anemia	Pubtator	26491070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	29296843, 30700418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	22642594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	20069064, 26854036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	9583810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	21471543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28054753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29738368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	11836257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16513158, 18611449, 24347824, 28677755, 28822264, 29678642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	11836257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	15529360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18163955, 31727095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18608178, 19709444, 32358783, 9664071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28301607, 31727095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	35742939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10221440, 11022984, 11775547, 19821156, 27723652, 31848359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27723652, 37511459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	22806482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23392055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11854737, 24347824, 7556627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16513158, 18611449, 24347824, 28677755, 28822264, 29678642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	17934269, 26976620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31147808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	23231720	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10489932, 12791317, 14625545, 20806409, 23973223, 25687737, 28032847, 29679484, 30622969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24425585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27864821, 30262300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	23464395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28380264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	30770860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	19026123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	21345207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	33054049	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	40085946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	28638943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19766166, 23938235		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	23938235, 25891376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21889367, 28794159, 29802537, 30104251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	15155749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	29566034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17611651, 19659607, 23807299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10884417, 11820785, 15784178, 15994930, 17487411, 18587674, 19889640, 22490496, 25173798, 26977021, 29491085, 30175665, 30643287, 30917858, 31077235 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10884417, 11795468, 18987994, 19277710, 19889640, 20153327, 22002548, 22957077, 23007635, 25159299, 26497673, 26553005, 31839604, 34180400, 34636027, 36417489, 8926389 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	11775547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	12657679, 28680390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	30194286, 37569852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	21498475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17131471, 21517111, 21891896, 28420430, 32796891, 37884988, 38376300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11193027, 22914605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	33162788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	34243615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12918137, 15810071, 16222756, 16224158, 16237753, 19331200, 20180806, 20480522, 24516705, 24747592, 24923353, 25798051, 25982372, 26797961, 28028759 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24386414, 26494212, 29569872	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21889367, 28794159, 29802537, 30104251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	20691082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20704535, 22037874, 23792430, 24481441, 26197988, 28028759, 28079882, 28232384, 29137250, 30245753, 30257315, 30864724, 30967859, 31792442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27460076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34955688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36833281	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17580361, 21522149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	9741542	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24565018, 30983127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16714144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	12057908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28737514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12057908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29128340, 29678642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30645756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	11331850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	18940912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	26001928	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	28849427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	BEFREE	28667374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23154057, 24323423, 26212861, 27896629, 28169530, 8930384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12008944, 21167846, 26976620, 29421932, 30120034, 30147017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	30931849		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19507834, 28237487, 29023986, 31772669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19507834, 28237487, 29023986, 31772669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease, Type Ia (disorder)	Charcot-Marie-Tooth disease	BEFREE	25694550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	28380264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21750953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	21750953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22051775	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	24398013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24347824, 29939312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23160471, 27312846, 31044428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24252366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20156737, 24095952, 29067554, 30268700, 30298576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30804561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	25530681, 32493865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	28784015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	26491070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21443787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30515398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19686046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29051186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22297444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1458470, 18097612, 21725599, 21739554, 26197988, 31199053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	17580361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15742415, 17580361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16258706, 22613625, 22669480, 23319326, 24362470, 25437815, 27129500, 27207671, 28791678, 30273495, 30452400, 31441584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11189449, 12633846, 15742415, 17235439, 19208367, 22669480, 27129500, 30452400, 33600380, 34199046, 35720311, 36303457, 38179732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28143990	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	28638943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	21750953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16714144, 18759004, 24748476, 30390173, 31576776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25374234, 9413152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	9004152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	38275751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	20300519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19333379, 20300519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28784015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10466882, 10489932, 24790089, 28792733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28792733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	30529510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	28487847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20534503, 22069317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22069317, 24609033, 29752334, 29986884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26586481, 30024275, 30622281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	11200684, 15832029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29524264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	26419317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	26251042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30770860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30129410, 30853267, 31392909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35957827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18843550, 30129410, 30853267, 31392909, 31485911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31816668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37123136	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33542414, 36303457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18229449, 31816668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20067962, 29752628	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12791317, 2272664, 28161055, 30622969, 30644701, 30853267, 7903628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18518860, 28246355, 28903474, 29752628, 29781744, 30255491, 31816668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	31327552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	18518860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	38376300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29147614, 8033225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11417611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	19626584, 24051039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	24395566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	19277710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	28794131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	31746233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	25879409, 29438905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	26419317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28672958, 30515398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19399947, 31077235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19399947, 21333981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	30200092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18596029, 21333981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21333981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39519195	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16048836, 22417223, 28559979, 28672958, 29538301, 29964156, 30308130, 30605673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32748370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	22417223, 30605673, 31319099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrokeratodermia variabilis	Erythrokeratodermia Variabilis	BEFREE	26251042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15637761, 19443372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21517111, 28277193, 32375686, 33069225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	17131471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	19085089, 29679484, 8645252		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	19085089	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Essential tremor	Pubtator	24252366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	18066588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30746368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	28215707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	28215707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	28215707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Syndrome	Fanconi Syndrome	BEFREE	28215707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	19457057	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	31063128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	8688318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	30343606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	31498123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	22610150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	24395566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	23464395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	21095095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	27789271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	36889696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	20069064, 29107807, 29442021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	20069064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	20069064, 23378726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20069064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11193027, 24678590, 24833463, 25097859, 26419972, 27777286, 28212737, 28849427, 29177668, 29348557, 30967859, 31430337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20617365, 25097859, 31287950, 31430337, 32276468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11193027, 24678590, 24833463, 25097859, 26419972, 27777286, 28212737, 28849427, 29177668, 29348557, 30967859, 31430337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21521685, 21732139, 24305705, 24833463, 27777286, 28849427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	16204210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	30062391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	15818324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29906586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	1673096, 26782485, 8645252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	1673096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	22208848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	29904402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12915945, 15705872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	26121033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	17009596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss, High-Frequency	Hearing Loss	BEFREE	15497506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	14587309	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	14587309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16714144, 18759004, 24748476, 30390173, 31576776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	16714144, 18759004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	19821156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16627469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	30214417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	23837438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	26494212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	33288711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	9222603, 9840686		★★★★★ ★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	19351530, 22508396, 26436397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30617950, 31485911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	12706247, 17251428, 21775503, 23225230, 30617950, 31485911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	22273152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	23985558	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28161055, 30129410, 30132875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	9576870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30132875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphenylalaninaemia	Hyperphenylalaninemia	BEFREE	28794131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19085089	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	19085089, 23154057, 28849507, 29679484, 30217924, 31321561, 31599538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	1673096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	23447019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25103413	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34162953	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28285429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29482057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19347046, 20513440, 26496868, 27638903, 30543447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	23262513, 26496868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29383113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21443787, 30515398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	17880957, 35742939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10489932, 25437815, 28126021, 31717769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16909434, 22297444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29180269	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23975543	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	25292174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28794131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36248807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	22914614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17582394, 23154057, 30931849, 31218845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	26587836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	29054323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18229449	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29402790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	32876904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	12840151, 19745103, 29402790, 31593741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	20858601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	8187328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10089909, 11189449, 15388581, 15832946, 17009597, 18382692, 18759005, 20694586, 23152061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18297536		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18297536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11189449, 15388581, 23669290, 24885082, 27802968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	21233201, 23109422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	9222603, 9840686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24885082, 30716336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	16319716, 18248624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	18248624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12500205, 14987991, 20603246, 2154980, 22914605, 22914614, 23836405, 24923353, 25473902, 25798051, 25955691, 25982372, 26010766, 26494212, 26647961 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14987991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26494212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26494212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	2154980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	BEFREE	26670457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	22096546, 23837438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22957077, 26134408, 28028759, 28079882, 28848092, 29524558, 37948404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27090786, 30967859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28095607, 8408920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	1335295	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20498198, 2256734, 8345220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28095607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11704801, 1335295, 20498198, 28095607, 30768443, 8216691, 8305922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28095607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25379943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23160471, 28842558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24518719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	9338474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	9338474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	10575031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	12763290, 28550365, 30180869, 8645252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30719212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12915945, 15705872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	31428976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10884417, 11820785, 1373500, 15784178, 15994930, 17487411, 18587674, 19889640, 20153327, 22490496, 25173798, 26977021, 29491085, 30175665, 30643287 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19399947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26745065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	8528482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29901164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20704535, 22037874, 23792430, 24481441, 28028759, 28079882, 28232384, 29137250, 30245753, 30257315, 30864724, 30967859, 31792442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	10585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	21498475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24565018, 30983127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22261331, 28543919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14981946, 17578680, 17595048, 18381433, 25578495, 28691182, 29764864, 29772540, 30446660, 30972796, 31222811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	14604899, 18822691, 19626584, 24051039, 24473833, 28192510, 28731175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17487411, 21889367, 28794159, 29802537, 30104251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11399124, 12270543, 12499245, 14512773, 14604899, 15609400, 15705872, 15741319, 16399896, 16618741, 17968683, 19270509, 19277710, 19889640, 20123884 View all (72 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19507834, 28237487, 29023986, 31772669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18097612, 21725599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31485911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11820785, 12174871, 18987994, 22002548, 31839604, 7819588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	PSYGENET_DG	23938235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	28088747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29147614, 9222603, 9840686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	29323280, 29666155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	25435367, 28038712, 31027376		★★★★★ ★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALIC LEUKOENCEPHALOPATHY WITH SUBCORTICAL CYSTS	Megalencephalic Leukoencephalopathy With Subcortical Cysts	BEFREE	9840686		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10602000, 16617300, 22351686, 23415401, 27881057, 28679643, 31375996, 31489735, 9607628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14612316, 17094481, 19383316, 22872370, 25863038, 36303457, 36417489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	17094481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	10201752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25269047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29524264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	24694787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	19551156, 33319489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	24565018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33319489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	37123136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27864821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	25670781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	19582769		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	19582769		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	21333981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12491534, 16627469, 19383903, 23887058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16627469, 18503584, 19383903, 23065523, 23887058, 35853457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11696222, 20806409, 22669475, 24075312, 24485944, 30124009, 7722338, 8529121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	38003363, 8529121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	26205529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	CTD_human_DG	12868502		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22160620, 31617351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22160620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10089909, 15155749, 15388581, 17109025, 18429957, 19246153, 23190580, 31289206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16714144, 30931849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22642594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	9004152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31576776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	26205529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21498475, 26198046, 29393436, 31564980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21498475, 22591702, 26198046, 29393436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	17235439	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10089909, 10585574, 11193027, 11399124, 11712786, 12270543, 12737518, 12839959, 1396553, 14678977, 14970875, 15127237, 15133843, 15374979, 15592361 View all (101 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	11445853, 11712786, 16769335, 28711961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	29054323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	27769261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30062391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	30062391	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30605673, 31509197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	21903608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10588512, 11775244, 18066588, 18182047, 18431252, 18991684, 19628086, 20638672, 21903608, 26135068, 28985943, 29274099, 30579945, 31347062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18797883, 20490276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	21133677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33798554	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10581028, 16644868, 18182047, 18382657, 19208651, 22909049, 23985416, 25147790, 25427613, 26668376, 27941812, 28559789, 28847953, 28903474, 29107085 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15933475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	31395886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29120605, 30090490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Diseases	Sphingomyelinase deficiency	BEFREE	20519957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29631603		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15696546, 21971866, 22948392, 27770383, 28232384, 28274158, 29093708, 29111316, 29807114, 30429459, 30967859, 31591429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23975543	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25292174, 34632798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28903474, 29524264, 30255491, 31678111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	12217291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	21891896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30024275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12012007, 24846187, 26311104, 27259322, 28466152, 29151914, 29432736, 30902071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23027359, 28466152, 30902071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	28964286		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24565018, 30983127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35840928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	15764345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22261331, 28543919, 30308458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19208367, 24129563, 24312717, 26579577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28543919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	30343606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11200684, 18182047, 22544056, 24279716, 26135068, 26742515, 28230968, 28810585, 29107085, 29183796, 29471019, 29704482, 30113007, 31408661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	18248624, 22544056, 25054189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	18248624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	25687737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32493865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	29120605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	10652040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	28810585, 30656694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	31498123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	29111316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31399035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34632798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	24252366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	23831493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	30770860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	28638943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	31521893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	26854036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	20156737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	15050720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	18587674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14981946, 17578680, 17595048, 18381433, 25578495, 28691182, 29764864, 29772540, 30446660, 30972796, 31222811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11903689, 28691182, 30297360, 36773708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25578495	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29197065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	30062391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	36497125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic episodes	Psychosis	BEFREE	24548631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27769261, 37077366, 38641747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30298576	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	26436397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18799101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20513440, 22096546, 30543447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17616937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25374234, 9413152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	12235111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	8033225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30635925, 30975014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11775244, 8078944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	8078944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	27450084, 30131440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30131440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10604236, 10958354, 12037598, 18608178, 19709444, 20806409, 24550170, 30465159, 30873163, 31262206, 31727095, 8645252, 9243760, 9820598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	33743591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15963589, 18299791, 19643584, 23893339, 30342847, 8645252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	25244257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11797016, 25891376, 28119177, 28350760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	20331449, 8408920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	19895425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	16101145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27704355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	28716533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	28716533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	29086205		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	28349254, 31553796, 31637977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar ataxia 14	Spinocerebellar Ataxia	BEFREE	24021284, 30093405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	BEFREE	15494410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	33626063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10585574, 21522149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20635445, 21345207, 21891896, 24518707, 24912482, 26755347, 32110810, 35854245, 35957827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38376300	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26755347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31319099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18822691, 19626584, 24051039, 24473833, 28192510, 28731175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20065505, 22208848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15609400, 15962384, 22610150, 25379943, 26646027, 29843139, 30066840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17235439	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27644641	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stress Disorders, Traumatic	Stress Disorder	BEFREE	12763290, 30486339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31273911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	18799101		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	24492285, 8561799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	30594066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	22039833, 22236337, 23271055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	24252366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	8289596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16788983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	16038410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	9672243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	18981002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38081808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10489932, 25437815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	12763290, 8645252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12942564, 24718854, 29802537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	9741542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	9741542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	30285148, 31283944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	28849011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	18372927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	18372927, 33270690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	15816839, 23447019, 28380264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	15816839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	15816839, 23447019, 28380264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Warburg Sjo Fledelius syndrome	Warburg micro syndrome	Pubtator	24923353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	15603737		★★★★★ ★☆☆☆☆ Found in Text Mining only

HSPA4 (heat shock protein family A (Hsp70) member 4)