HSPA2 (heat shock protein family A (Hsp70) member 2)

Gene

• Entrez ID: 3306
• Gene name: Heat shock protein family A (Hsp70) member 2
• Gene symbol: HSPA2
• Synonyms (NCBI Gene): HSP70-2, HSP70-3
• Chromosome: 14
• Chromosome location: 14q23.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024730	hsa-miR-215-5p	Microarray	19074876
MIRT026895	hsa-miR-192-5p	Microarray	19074876
MIRT036912	hsa-miR-877-3p	CLASH	23622248
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT632863	hsa-miR-3929	HITS-CLIP	23824327
MIRT632862	hsa-miR-4419b	HITS-CLIP	23824327
MIRT632861	hsa-miR-4478	HITS-CLIP	23824327
MIRT632860	hsa-miR-5690	HITS-CLIP	23824327
MIRT632859	hsa-miR-8088	HITS-CLIP	23824327
MIRT632858	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT632857	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT632856	hsa-miR-7977	HITS-CLIP	23824327
MIRT632855	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT527555	hsa-miR-5003-5p	PAR-CLIP	20371350
MIRT527555	hsa-miR-5003-5p	PAR-CLIP	22012620
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT632863	hsa-miR-3929	HITS-CLIP	23824327
MIRT632862	hsa-miR-4419b	HITS-CLIP	23824327
MIRT632861	hsa-miR-4478	HITS-CLIP	23824327
MIRT632860	hsa-miR-5690	HITS-CLIP	23824327
MIRT632859	hsa-miR-8088	HITS-CLIP	23824327
MIRT632858	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT632857	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT632856	hsa-miR-7977	HITS-CLIP	23824327
MIRT632855	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610010	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT610009	hsa-miR-3162-3p	HITS-CLIP	23824327
MIRT610008	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610007	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610006	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT527555	hsa-miR-5003-5p	PAR-CLIP	20371350
MIRT527555	hsa-miR-5003-5p	PAR-CLIP	22012620
MIRT1056135	hsa-miR-3143	CLIP-seq
MIRT1056136	hsa-miR-3144-3p	CLIP-seq
MIRT1056137	hsa-miR-33a	CLIP-seq
MIRT1056138	hsa-miR-33b	CLIP-seq
MIRT1056139	hsa-miR-450b-5p	CLIP-seq
MIRT1056140	hsa-miR-4729	CLIP-seq
MIRT1056141	hsa-miR-491-3p	CLIP-seq
MIRT1056142	hsa-miR-518a-5p	CLIP-seq
MIRT1056143	hsa-miR-527	CLIP-seq
MIRT1056144	hsa-miR-548an	CLIP-seq
MIRT1056145	hsa-miR-548l	CLIP-seq
MIRT1056146	hsa-miR-548n	CLIP-seq
MIRT1056147	hsa-miR-583	CLIP-seq
MIRT1056148	hsa-miR-586	CLIP-seq
MIRT1056149	hsa-miR-875-5p	CLIP-seq
MIRT2682473	hsa-miR-3613-3p	CLIP-seq
MIRT2682474	hsa-miR-4457	CLIP-seq
MIRT2682475	hsa-miR-495	CLIP-seq
MIRT2682476	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000795	Component	Synaptonemal complex	IEA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 25036637, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	21231916
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006457	Process	Protein folding	IBA
GO:0006986	Process	Response to unfolded protein	IEA
GO:0006986	Process	Response to unfolded protein	TAS	7829106
GO:0007140	Process	Male meiotic nuclear division	IEA
GO:0007140	Process	Male meiotic nuclear division	TAS	8622925
GO:0007141	Process	Male meiosis I	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007286	Process	Spermatid development	IEA
GO:0007286	Process	Spermatid development	TAS	8622925
GO:0009408	Process	Response to heat	ISS
GO:0009409	Process	Response to cold	ISS
GO:0009986	Component	Cell surface	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23921388
GO:0030154	Process	Cell differentiation	IEA
GO:0031072	Function	Heat shock protein binding	IBA
GO:0036128	Component	CatSper complex	IEA
GO:0036128	Component	CatSper complex	ISS
GO:0042026	Process	Protein refolding	IBA
GO:0042026	Process	Protein refolding	IDA	21231916
GO:0042026	Process	Protein refolding	IEA
GO:0044183	Function	Protein folding chaperone	IBA
GO:0048156	Function	Tau protein binding	IEA
GO:0051082	Function	Unfolded protein binding	IDA	21231916
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	TAS	3037489
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0051861	Function	Glycolipid binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070194	Process	Synaptonemal complex disassembly	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0072687	Component	Meiotic spindle	IEA
GO:0072687	Component	Meiotic spindle	ISS
GO:0090084	Process	Negative regulation of inclusion body assembly	IDA	21231916
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA

Other IDs

• MIM: 140560
• HGNC: 5235
• e!Ensembl: ENSG00000126803

Protein

• UniProt ID: P54652
• Protein name: Heat shock-related 70 kDa protein 2 (Heat shock 70 kDa protein 2) (Heat shock protein family A member 2)
• Protein function: Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation
• PDB: 3I33, 4FSV, 5FPD, 5FPE, 5FPM, 5FPN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00012	HSP70	7 → 615	Hsp70 protein	Family

• Sequence:

  MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
  AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
  SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
  AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
  VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
  TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
  ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
  TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
  FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
  AKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
  ELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD

• Sequence length: 639

Pathways

KEGG:

Antigen processing and presentation
Lipid and atherosclerosis

Reactome:

Regulation of HSF1-mediated heat shock response
HSP90 chaperone cycle for steroid hormone receptors (SHR)
Attenuation phase

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	15714129, 17940904		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28670489		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	7579351, 7961560		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30137212, 34480088	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36246562	Stimulate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	11779758		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	21471543		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16513158		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	27209630		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	27209630	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16513158		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	19661373	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	8655362		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	10856471, 25439847		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	25439847	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19914824		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11241233, 23065205, 31406303, 9338474		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26576432, 31101846	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17363574		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25117073	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19914824		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20704535, 26930648		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25890028	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25213699	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28670489		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26728972		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	15992611, 16953332		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	8096093		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12008944		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22542718		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17594690, 27473057		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	15205404		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18759004		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25213699, 9973436		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22834788, 25108126		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16953332, 22834788, 25108126		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22834788	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22834788, 25108126		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10466882, 12730033, 16165702, 17301649, 17532782		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25308252		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15223990		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15223990		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28246355	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	7901896, 8884848		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15223990, 15992611, 26728972		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28246355	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	24051039		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28670489		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23777267	Stimulate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	31378672		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	31378672	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	24054763	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	19661373	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11678832, 26782485		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	26782485	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	26547206		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	22834788		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30217924		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31323898		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	26547206		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	11730740, 23209833	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11040178		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	28246355	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25117073		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	BEFREE	26670457		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11196683, 7551654, 8655362		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23777267, 25890028	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	9338474		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23065205, 31406303		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20704535, 26930648		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28670489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25890028, 30988777		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24054763		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18478330		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	28670489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19914824		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17363574, 18452162, 21496299, 31406303, 31591429, 9338474		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25308252		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	16636682	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11696222, 24485944, 27609295		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12691826, 23667540		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15970673, 19914824, 23777267, 25117073, 25890028, 27473057, 28416384, 31406303, 9973436		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27405095		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18452162, 31591429		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15223990, 26728972		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26728972	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	11040178		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28670489		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25890028, 28416384, 30988777		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25890028		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22797398, 25890028	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	15714129		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	22797398	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	22797398	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	25412654		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24054763		★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	16333988	Stimulate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25213699, 9973436		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	33743591	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	31006710		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	31006710	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23777267		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18478330		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	19661373	Associate	★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	15205404		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	15992611		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	19914824, 27473057		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37306188	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17532782		★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19914824		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	LHGDN	17007855		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29530785		★☆☆☆☆ Found in Text Mining only