Gene Gene information from NCBI Gene database.
Entrez ID 3300
Gene name DnaJ heat shock protein family (Hsp40) member B2
Gene symbol DNAJB2
Synonyms (NCBI Gene)
CMT2TDSMA5HMNR5HSJ-1HSJ1HSPF3
Chromosome 2
Chromosome location 2q35
Summary This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and pro
SNPs SNP information provided by dbSNP.
9
SNP ID Visualize variation Clinical significance Consequence
rs369661561 A>G Likely-pathogenic Splice acceptor variant
rs562669797 T>A Likely-pathogenic Splice donor variant
rs730882139 G>A Pathogenic, conflicting-interpretations-of-pathogenicity Splice donor variant
rs730882140 A>G Pathogenic, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs756614404 G>A Pathogenic, uncertain-significance Splice donor variant
miRNA miRNA information provided by mirtarbase database.
131
miRTarBase ID miRNA Experiments Reference
MIRT042091 hsa-miR-484 CLASH 23622248
MIRT614188 hsa-miR-141-5p HITS-CLIP 23824327
MIRT614187 hsa-miR-338-3p HITS-CLIP 23824327
MIRT614186 hsa-miR-6788-3p HITS-CLIP 23824327
MIRT614185 hsa-miR-1238-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
57
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IDA 15936278
GO:0001671 Function ATPase activator activity IBA
GO:0001671 Function ATPase activator activity IDA 7957263, 22219199
GO:0005515 Function Protein binding IPI 12754272, 15936278, 21625540, 21719532, 24023695, 25036637, 33961781
GO:0005634 Component Nucleus IDA 12754272
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604139 5228 ENSG00000135924
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P25686
Protein name DnaJ homolog subfamily B member 2 (Heat shock 40 kDa protein 3) (Heat shock protein J1) (HSJ-1)
Protein function Functions as a co-chaperone, regulating the substrate binding and activating the ATPase activity of chaperones of the HSP70/heat shock protein 70 family (PubMed:22219199, PubMed:7957263). In parallel, also contributes to the ubiquitin-dependent
PDB 2LGW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 3 66 DnaJ domain Domain
Tissue specificity TISSUE SPECIFICITY: More abundantly expressed in neocortex, cerebellum, spinal cord and retina where it is expressed by neuronal cells (at protein level) (PubMed:12754272, PubMed:1599432). Detected at much lower level in non-neuronal tissues including kid
Sequence
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYD
RYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDL
GPFSELQNRGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT
TRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTP
ASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQ
EGARGEATKRSPSPEEKASRCLIL
Sequence length 324
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Protein processing in endoplasmic reticulum  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
24
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autosomal recessive distal spinal muscular atrophy 2 Pathogenic; Likely pathogenic rs730882139, rs730882140, rs756614404 RCV003447120
RCV003447121
RCV003447123
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Charcot-Marie-Tooth disease Pathogenic; Likely pathogenic rs730882139, rs730882140, rs756614404 RCV000192265
RCV000192266
RCV000789088
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Charcot-Marie-Tooth disease axonal type 2T Pathogenic rs797045039 RCV000191078
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Charcot-Marie-Tooth disease X-linked dominant 1 Pathogenic rs756614404 RCV002051587
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease type 2 Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2T Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 24023695, 28031292
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis Pubtator 28031292 Associate
★☆☆☆☆
Found in Text Mining only
Amyotrophy, monomelic Monomelic Amyotrophy BEFREE 19412816
★☆☆☆☆
Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked Bulbospinal Atrophy, X-Linked BEFREE 20395441
★☆☆☆☆
Found in Text Mining only
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth Disease BEFREE 28031292
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth Disease CLINVAR_DG
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2T Charcot-Marie-Tooth Disease CLINVAR_DG 26633545
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Distal Hereditary Motor Neuropathy Type II Distal hereditary motor neuropathy Pubtator 28031292 Associate
★☆☆☆☆
Found in Text Mining only
DNAJB2-related Charcot-Marie-Tooth disease type 2 Charcot-Marie-Tooth Disease Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hearing Loss Hearing loss Pubtator 35286755 Associate
★☆☆☆☆
Found in Text Mining only