Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	3298
Gene name	Heat shock transcription factor 2
Gene symbol	HSF2
Synonyms (NCBI Gene)	HSF 2HSTF 2
Chromosome	6
Chromosome location	6q22.31
Summary	The protein encoded by this gene belongs to the HSF family of transcription factors that bind specifically to the heat-shock promoter element and activate transcription. Heat shock transcription factors activate heat-shock response genes under conditions

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005361	hsa-miR-18a-5p	ImmunofluorescenceIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	20724452
MIRT005361	hsa-miR-18a-5p	ImmunofluorescenceIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	20724452
MIRT029326	hsa-miR-26b-5p	Microarray	19088304
MIRT030504	hsa-miR-24-3p	Microarray	19748357
MIRT052530	hsa-let-7a-5p	CLASH	23622248
MIRT052530	hsa-let-7a-5p	CLASH	23622248
MIRT052083	hsa-let-7b-5p	CLASH	23622248
MIRT1055730	hsa-miR-2277-3p	CLIP-seq
MIRT1055731	hsa-miR-4282	CLIP-seq
MIRT1055732	hsa-miR-495	CLIP-seq
MIRT1055733	hsa-miR-569	CLIP-seq
MIRT1055734	hsa-miR-570	CLIP-seq
MIRT2245117	hsa-miR-1179	CLIP-seq
MIRT1055730	hsa-miR-2277-3p	CLIP-seq
MIRT2245118	hsa-miR-3919	CLIP-seq
MIRT2245119	hsa-miR-4266	CLIP-seq
MIRT2245120	hsa-miR-4468	CLIP-seq
MIRT2245121	hsa-miR-4653-3p	CLIP-seq
MIRT2245122	hsa-miR-651	CLIP-seq
MIRT2437653	hsa-miR-147	CLIP-seq
MIRT2437654	hsa-miR-2276	CLIP-seq
MIRT2437655	hsa-miR-3194-3p	CLIP-seq
MIRT2437656	hsa-miR-3591-3p	CLIP-seq
MIRT2437657	hsa-miR-3622a-3p	CLIP-seq
MIRT2437658	hsa-miR-3622b-3p	CLIP-seq
MIRT2437659	hsa-miR-3911	CLIP-seq
MIRT2437660	hsa-miR-4696	CLIP-seq
MIRT2437661	hsa-miR-4766-5p	CLIP-seq
MIRT2437662	hsa-miR-4772-3p	CLIP-seq
MIRT2437663	hsa-miR-574-5p	CLIP-seq
MIRT2437664	hsa-miR-644	CLIP-seq
MIRT2548034	hsa-miR-1270	CLIP-seq
MIRT2548035	hsa-miR-1273g	CLIP-seq
MIRT2548036	hsa-miR-144	CLIP-seq
MIRT2437653	hsa-miR-147	CLIP-seq
MIRT2548037	hsa-miR-18a	CLIP-seq
MIRT2548038	hsa-miR-18b	CLIP-seq
MIRT2437654	hsa-miR-2276	CLIP-seq
MIRT2548039	hsa-miR-3121-3p	CLIP-seq
MIRT2548040	hsa-miR-3140-3p	CLIP-seq
MIRT2548041	hsa-miR-3174	CLIP-seq
MIRT2437655	hsa-miR-3194-3p	CLIP-seq
MIRT2548042	hsa-miR-3200-5p	CLIP-seq
MIRT2548043	hsa-miR-330-3p	CLIP-seq
MIRT2437656	hsa-miR-3591-3p	CLIP-seq
MIRT2548044	hsa-miR-3606	CLIP-seq
MIRT2548045	hsa-miR-3613-3p	CLIP-seq
MIRT2437657	hsa-miR-3622a-3p	CLIP-seq
MIRT2437658	hsa-miR-3622b-3p	CLIP-seq
MIRT2548046	hsa-miR-3692	CLIP-seq
MIRT2437659	hsa-miR-3911	CLIP-seq
MIRT2548047	hsa-miR-3920	CLIP-seq
MIRT1055731	hsa-miR-4282	CLIP-seq
MIRT2548048	hsa-miR-4434	CLIP-seq
MIRT2548049	hsa-miR-4516	CLIP-seq
MIRT2548050	hsa-miR-4531	CLIP-seq
MIRT2437660	hsa-miR-4696	CLIP-seq
MIRT2548051	hsa-miR-4735-3p	CLIP-seq
MIRT2437661	hsa-miR-4766-5p	CLIP-seq
MIRT2437662	hsa-miR-4772-3p	CLIP-seq
MIRT1055732	hsa-miR-495	CLIP-seq
MIRT2548052	hsa-miR-520d-5p	CLIP-seq
MIRT2548053	hsa-miR-524-5p	CLIP-seq
MIRT2548054	hsa-miR-539	CLIP-seq
MIRT2548055	hsa-miR-548k	CLIP-seq
MIRT2548056	hsa-miR-548n	CLIP-seq
MIRT2548057	hsa-miR-548p	CLIP-seq
MIRT1055733	hsa-miR-569	CLIP-seq
MIRT1055734	hsa-miR-570	CLIP-seq
MIRT2437663	hsa-miR-574-5p	CLIP-seq
MIRT2548058	hsa-miR-620	CLIP-seq
MIRT2437664	hsa-miR-644	CLIP-seq
MIRT2548059	hsa-miR-921	CLIP-seq
MIRT2548035	hsa-miR-1273g	CLIP-seq
MIRT2548036	hsa-miR-144	CLIP-seq
MIRT2437653	hsa-miR-147	CLIP-seq
MIRT2548037	hsa-miR-18a	CLIP-seq
MIRT2548038	hsa-miR-18b	CLIP-seq
MIRT2437654	hsa-miR-2276	CLIP-seq
MIRT2548039	hsa-miR-3121-3p	CLIP-seq
MIRT2548040	hsa-miR-3140-3p	CLIP-seq
MIRT2548041	hsa-miR-3174	CLIP-seq
MIRT2437655	hsa-miR-3194-3p	CLIP-seq
MIRT2548042	hsa-miR-3200-5p	CLIP-seq
MIRT2548043	hsa-miR-330-3p	CLIP-seq
MIRT2437656	hsa-miR-3591-3p	CLIP-seq
MIRT2548044	hsa-miR-3606	CLIP-seq
MIRT2437657	hsa-miR-3622a-3p	CLIP-seq
MIRT2437658	hsa-miR-3622b-3p	CLIP-seq
MIRT2548046	hsa-miR-3692	CLIP-seq
MIRT2437659	hsa-miR-3911	CLIP-seq
MIRT2548047	hsa-miR-3920	CLIP-seq
MIRT1055731	hsa-miR-4282	CLIP-seq
MIRT2437660	hsa-miR-4696	CLIP-seq
MIRT2548051	hsa-miR-4735-3p	CLIP-seq
MIRT2437661	hsa-miR-4766-5p	CLIP-seq
MIRT2437662	hsa-miR-4772-3p	CLIP-seq
MIRT1055732	hsa-miR-495	CLIP-seq
MIRT2548052	hsa-miR-520d-5p	CLIP-seq
MIRT2548053	hsa-miR-524-5p	CLIP-seq
MIRT2548054	hsa-miR-539	CLIP-seq
MIRT2548057	hsa-miR-548p	CLIP-seq
MIRT1055733	hsa-miR-569	CLIP-seq
MIRT1055734	hsa-miR-570	CLIP-seq
MIRT2437663	hsa-miR-574-5p	CLIP-seq
MIRT2437664	hsa-miR-644	CLIP-seq
MIRT2548059	hsa-miR-921	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	10561509
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	8972228
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001162	Function	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IDA	10561509
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10561509
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	25036637, 25416956, 25910212, 26727490, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10561509
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
140581	5225	ENSG00000025156

Q03933

Protein name

Heat shock factor protein 2 (HSF 2) (Heat shock transcription factor 2) (HSTF 2)

Protein function

DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked.

PDB

5D8K , 5D8L , 5HDK , 7DCI , 7DCU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00447	HSF_DNA-bind	10 → 110	HSF-type DNA-binding	Domain
PF06546	Vert_HS_TF	230 → 513	Vertebrate heat shock transcription factor	Family

Sequence

MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMAS
FVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENK
IRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQ
FIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVPHSRTEGLKPRE
RISDDIIIYDVTDDNADEENIPVIPETNEDVISDPSNCSQYPDIVIVEDDNEDEYAPVIQ
SGEQNEPARESLSSGSDGSSPLMSSAVQLNGSSSLTSEDPVTMMDSILNDNINLLGKVEL
LDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDLFTSSVQMNPTDYINNTKSENKGLETTK
NNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKP
IEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS

Sequence length

536

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	17213196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	9367915, 9738016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31680326		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Azoospermia	Azoospermia	BEFREE	23064888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	32756090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
BESTROPHINOPATHY, AUTOSOMAL RECESSIVE	Bestrophinopathy	BEFREE	29180262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain infarction	Pubtator	39736019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29799832		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35606363, 37077914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28796250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	39736019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24533153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28295305, 29180262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24533153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28277193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28295305, 29180262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35606363	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31497345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26119944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26119944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31497345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34134622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26119944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16837193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28058586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	40380263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26985959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26985959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24533153		★★★★★ ★☆☆☆☆ Found in Text Mining only

HSF2 (heat shock transcription factor 2)