Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3297
Gene name	Heat shock transcription factor 1
Gene symbol	HSF1
Synonyms (NCBI Gene)	HSTF1
Chromosome	8
Chromosome location	8q24.3
Summary	The product of this gene is a transcription factor that is rapidly induced after temperature stress and binds heat shock promoter elements (HSE). This protein plays a role in the regulation of lifespan. Expression of this gene is repressed by phosphorylat

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029982	hsa-miR-26b-5p	Microarray	19088304
MIRT439159	hsa-let-7c-5p	3'LIFE	25074381
MIRT439159	hsa-let-7c-5p	3'LIFE	25074381
MIRT1055712	hsa-miR-1197	CLIP-seq
MIRT1055713	hsa-miR-1275	CLIP-seq
MIRT1055714	hsa-miR-1292	CLIP-seq
MIRT1055715	hsa-miR-3675-3p	CLIP-seq
MIRT1055716	hsa-miR-3714	CLIP-seq
MIRT1055717	hsa-miR-4271	CLIP-seq
MIRT1055718	hsa-miR-4462	CLIP-seq
MIRT1055719	hsa-miR-4525	CLIP-seq
MIRT1055720	hsa-miR-4665-5p	CLIP-seq
MIRT1055721	hsa-miR-4706	CLIP-seq
MIRT1055722	hsa-miR-4723-5p	CLIP-seq
MIRT1055723	hsa-miR-4725-3p	CLIP-seq
MIRT1055724	hsa-miR-4747-5p	CLIP-seq
MIRT1055725	hsa-miR-4749-5p	CLIP-seq
MIRT1055726	hsa-miR-4781-5p	CLIP-seq
MIRT1055727	hsa-miR-548c-3p	CLIP-seq
MIRT1055728	hsa-miR-602	CLIP-seq
MIRT1055729	hsa-miR-625	CLIP-seq
MIRT1055715	hsa-miR-3675-3p	CLIP-seq
MIRT2012787	hsa-miR-4257	CLIP-seq
MIRT2012788	hsa-miR-4667-3p	CLIP-seq
MIRT2012789	hsa-miR-4725-5p	CLIP-seq
MIRT2012790	hsa-miR-504	CLIP-seq
MIRT2245106	hsa-miR-1910	CLIP-seq
MIRT2245107	hsa-miR-3173-5p	CLIP-seq
MIRT2245108	hsa-miR-3611	CLIP-seq
MIRT2245109	hsa-miR-3934	CLIP-seq
MIRT2245110	hsa-miR-4323	CLIP-seq
MIRT2245111	hsa-miR-4474-3p	CLIP-seq
MIRT2245112	hsa-miR-455-3p	CLIP-seq
MIRT2245113	hsa-miR-4687-3p	CLIP-seq
MIRT2245114	hsa-miR-4786-3p	CLIP-seq
MIRT2245115	hsa-miR-644	CLIP-seq
MIRT2245116	hsa-miR-652	CLIP-seq
MIRT2389200	hsa-miR-431	CLIP-seq
MIRT2389201	hsa-miR-4421	CLIP-seq
MIRT2451425	hsa-miR-146b-3p	CLIP-seq
MIRT2245107	hsa-miR-3173-5p	CLIP-seq
MIRT2451426	hsa-miR-485-5p	CLIP-seq
MIRT2451427	hsa-miR-874	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
CEBPB	Unknown	11801594
NCOA6	Activation	14960326
SIRT1	Activation	23349863
SIRT1	Unknown	19229036
TP53	Unknown	20180806

127

Show/Hide all (127)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8926278, 9341107
GO:0000165	Process	MAPK cascade	IDA	12917326
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	18794143
GO:0000776	Component	Kinetochore	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IEA
GO:0000792	Component	Heterochromatin	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	24504023
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	8926278, 8972228
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	24504023
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001162	Function	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IDA	10561509
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	8926278
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	7760831, 25963659
GO:0001701	Process	In utero embryonic development	IEA
GO:0001892	Process	Embryonic placenta development	IEA
GO:0003677	Function	DNA binding	IDA	7935471, 8455624, 9222587, 9341107, 9499401, 9727490, 10359787, 10413683, 10747973, 11514557, 11583998, 12659875, 12665592, 12917326, 16278218, 16554823, 26754925
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1871105, 10821850
GO:0005515	Function	Protein binding	IPI	9222587, 9499401, 10747973, 11583998, 12917326, 14707147, 15016915, 16278218, 17897941, 18451878, 18794143, 19684601, 21085490, 21597468, 23352416, 25036637, 25816751, 26159920, 26359349, 26496226, 26517842, 26727490, 26754925, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	8455624, 9341107, 10413683, 10747973, 12665592, 12917326, 14707147, 21085490, 25963659, 26159920
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	26359349
GO:0005654	Component	Nucleoplasm	IDA	10359787
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	8455624, 10413683, 10747973, 12917326, 21085490, 26159920
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	18794143
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	7760831
GO:0006397	Process	MRNA processing	IEA
GO:0006952	Process	Defense response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007143	Process	Female meiotic nuclear division	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0009408	Process	Response to heat	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016605	Component	PML body	IDA	11514557
GO:0019901	Function	Protein kinase binding	IPI	16278218
GO:0031072	Function	Heat shock protein binding	IDA	9727490, 11583998, 16278218
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	26359349
GO:0031490	Function	Chromatin DNA binding	IDA	21085490
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0034605	Process	Cellular response to heat	IDA	7760831, 7935471, 9222587, 9341107, 9499401, 10359787, 10413683, 10747973, 11514557, 11583998, 12659875, 12665592, 12917326, 14707147, 16554823, 17897941, 21085490, 26159920
GO:0034605	Process	Cellular response to heat	IEA
GO:0034605	Process	Cellular response to heat	IMP	8455624, 9727490
GO:0034620	Process	Cellular response to unfolded protein	IDA	15016915
GO:0035865	Process	Cellular response to potassium ion	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042802	Function	Identical protein binding	IDA	7935471, 9222587, 9727490, 11583998, 16554823, 26754925
GO:0042802	Function	Identical protein binding	IPI	26727490, 29997244
GO:0043200	Process	Response to amino acid	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	25963659
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045120	Component	Pronucleus	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	24504023
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	18794143
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10561509
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9341107, 9499401, 10747973, 11514557, 12659875, 12665592, 12917326, 15016915, 16278218, 21085490, 21597468, 24504023, 25963659, 26754925
GO:0046982	Function	Protein heterodimerization activity	IDA	9222587
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21085490
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0051879	Function	Hsp90 protein binding	IDA	11583998
GO:0060136	Process	Embryonic process involved in female pregnancy	IEA
GO:0061770	Function	Translation elongation factor binding	IDA	16554823
GO:0062029	Process	Positive regulation of stress granule assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	IDA	11583998
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071276	Process	Cellular response to cadmium ion	IDA	10359787, 11514557, 15016915
GO:0071280	Process	Cellular response to copper ion	IDA	15016915
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071478	Process	Cellular response to radiation	IEA
GO:0071480	Process	Cellular response to gamma radiation	IDA	26359349
GO:0072738	Process	Cellular response to diamide	IDA	15016915
GO:0090084	Process	Negative regulation of inclusion body assembly	IEA
GO:0090261	Process	Positive regulation of inclusion body assembly	IEA
GO:0097165	Component	Nuclear stress granule	IDA	10359787, 10747973, 11514557, 12665592, 14707147, 25963659
GO:0097431	Component	Mitotic spindle pole	IDA	18794143
GO:0097677	Function	STAT family protein binding	IEA
GO:0098847	Function	Sequence-specific single stranded DNA binding	IEA
GO:0101031	Component	Protein folding chaperone complex	IDA	8455624
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26344102
GO:0140296	Function	General transcription initiation factor binding	IPI	11005381
GO:1900034	Process	Regulation of cellular response to heat	IDA	11583998
GO:1901652	Process	Response to peptide	IEA
GO:1902512	Process	Positive regulation of apoptotic DNA fragmentation	IEA
GO:1903936	Process	Cellular response to sodium arsenite	IDA	15016915
GO:1904385	Process	Cellular response to angiotensin	IEA
GO:1904843	Process	Cellular response to nitroglycerin	IEA
GO:1904845	Process	Cellular response to L-glutamine	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	16554823
GO:1990910	Process	Response to hypobaric hypoxia	IEA
GO:1990911	Process	Response to psychosocial stress	IEA
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	IMP	26359349
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
140580	5224	ENSG00000185122

Q00613

Protein name

Heat shock factor protein 1 (HSF 1) (Heat shock transcription factor 1) (HSTF 1)

Protein function

Functions as a stress-inducible and DNA-binding transcription factor that plays a central role in the transcriptional activation of the heat shock response (HSR), leading to the expression of a large class of molecular chaperones, heat shock pro

PDB

2LDU , 5D5U , 5D5V , 5HDG , 5HDN , 7DCJ , 7DCS , 7DCT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00447	HSF_DNA-bind	18 → 118	HSF-type DNA-binding	Domain
PF06546	Vert_HS_TF	247 → 529	Vertebrate heat shock transcription factor	Family

Sequence

MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPY
SAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE
PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGR
PPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP
SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGS
VDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

Sequence length

529

Interactions

View interactions

	KEGG		Reactome
	Legionellosis		Regulation of HSF1-mediated heat shock response HSF1 activation Attenuation phase HSF1-dependent transactivation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (186)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	17213196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29194340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	10702402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	26320184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	31744878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	27457810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	23829269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24256636, 25167838, 26936937, 29973287		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	24256636		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	16950627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	24256636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	24256636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	26936937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	15152009	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	25205676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28783244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30273616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	35720321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	9664071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31825792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30273616		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28241425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	22885793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11820785, 12602923, 15358168, 1826346, 22042860, 22510516, 23959823, 24384723, 26223813, 27713164, 28454329, 29088759, 29398920, 29494616, 30127907 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22042860, 22510516, 25199534, 26223813, 27713164, 29494616, 30309986, 30887707, 32620236, 32964046, 33593922, 34783649, 36010586, 37890164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	16644868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15457556, 22586447, 22863008, 23386620, 24954509, 25205676, 28618124, 34239690, 35906200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24002609, 25537516, 26157141, 27755964, 27831650, 36482717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24136149, 25199534	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	22042860	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26197988, 31569342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37700464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34239690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34239690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24033540, 27997575, 28487934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	35069934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	31723063, 36056063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31723063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16678833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16678833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	27732059		★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	29285313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	39736019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31054961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	16885369, 31054961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21330448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	21330448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 2	Kidney Disease	BEFREE	29421151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29421151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26397138, 31044428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coffin-Lowry syndrome	Coffin-Lowry Syndrome	BEFREE	11189448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	24326519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15457556, 26197988, 29068469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15457556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15457556, 22613625, 28618124, 29348836, 29730197, 30546056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15457556	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	25380824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30546056, 32110802, 35006040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29626503, 29678661, 29992755, 30378117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28617974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	38602103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	28575284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	29979776, 30701477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29752334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	27283588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	35327643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28547133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18843550, 28547133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22955979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24853175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24853175, 40235068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24033540, 28487934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	24033540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28246289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30455644, 31150929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	29973287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	16303760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21233200, 27777286, 28241425, 29059166, 29962860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36878845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21233200, 27777286, 28241425, 29059166, 29962860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21732139, 27777286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28383811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29626503, 29678661, 29992755, 30378117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23225230, 24381308, 27017930, 28194040, 28970536, 29341886, 30941017		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	28246289, 29285313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	25982096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24002609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34162953	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28540808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	25292174	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29278438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	29606348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31545442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	21652633		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26473447, 28128329, 30038221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28128329, 36245043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27296951, 32959058, 34719869, 36069792, 36245043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22751135, 27296951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20198330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17847074, 23615731, 24130164, 24136149, 24849358, 25199534, 25537516, 26010766, 26157141, 28454329, 28889000, 28903330, 29207593, 29398920, 31497221, 31497345, 31540279, 31815039 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24849358, 26157141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31569342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32141435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30326922, 35434944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	40235068	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22751135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24518719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11820785, 12602923, 15358168, 1826346, 22042860, 22510516, 23959823, 24384723, 26223813, 27713164, 28454329, 29088759, 29398920, 29494616, 30127907 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24853175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	16303760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	22470109, 26298773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28903330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31569342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20198330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24033540, 27997575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21330448, 28482903, 28783244, 29398920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10702402, 25199534, 30131848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30326922, 30328318, 3290903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11820785, 16885369, 17889643, 17889646, 17922035, 19335068, 19668225, 21330448, 22042860, 22751135, 22804234, 22863008, 22885793, 22964629, 23510323 View all (47 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	22885793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	22945628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31054961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15457556, 26223813, 29068469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11820785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29067111, 31409638		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21044828, 24165036, 25194503, 25435429, 31561952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26018731, 35906200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29131275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	29131275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28183717, 29941492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26157141	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25898974, 27487129, 31899217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28453931, 29296831, 29391353, 29440176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29992755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	32141435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nance-Horan syndrome	Nance-Horan Syndrome	BEFREE	31506350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21803736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32119704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11820785, 15358168, 1826346, 20622894, 21330448, 21879256, 22042860, 22215620, 22613625, 22885793, 22945628, 23615731, 23636216, 24106905, 24165036 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	22885793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17680992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24849358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24326519, 25204655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16644868, 20098725, 20166962, 22129991, 27835876, 27975203, 28852220, 29341886, 29734798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	22945628, 30931649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	24326519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25292174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26344102, 29941492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22042860, 22510516, 27713164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22077664, 28370690, 28453502, 29398920		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24033540, 27997575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37598177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21330448, 28482903, 28783244, 29398920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28482903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21330448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	16525201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	21330448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29194340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	28586010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29704482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30038221, 31744878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	27283588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10702402, 15152009, 30131848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10702402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	32141435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	22470109, 26298773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24366665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35720321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	27058144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	19817876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	19817876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20198330, 31402952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28454329, 29398920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34239690, 36200687, 36700826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28887499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28246289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30326922, 30328318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29339121, 30326922, 30328318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	39736019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28678786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28717943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33268814, 37404810, 38081808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36622366	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35434944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16885369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	39519208	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

HSF1 (heat shock transcription factor 1)