Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	329
Gene name	Baculoviral IAP repeat containing 2
Gene symbol	BIRC2
Synonyms (NCBI Gene)	API1HIAP2Hiap-2MIHBRNF48c-IAP1cIAP1
Chromosome	11
Chromosome location	11q22.2
Summary	The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded prote

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005820	hsa-miR-204-5p	ImmunoblotLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21282569
MIRT022141	hsa-miR-124-3p	Microarray	18668037
MIRT755994	hsa-miR-634	Luciferase reporter assayWestern blotting	35571376
MIRT821534	hsa-miR-1297	CLIP-seq
MIRT821535	hsa-miR-135a	CLIP-seq
MIRT821536	hsa-miR-135b	CLIP-seq
MIRT821537	hsa-miR-26a	CLIP-seq
MIRT821538	hsa-miR-26b	CLIP-seq
MIRT821539	hsa-miR-3065-5p	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT821541	hsa-miR-338-5p	CLIP-seq
MIRT821542	hsa-miR-421	CLIP-seq
MIRT821543	hsa-miR-4255	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT821545	hsa-miR-4465	CLIP-seq
MIRT821546	hsa-miR-4519	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT821548	hsa-miR-4760-5p	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT821539	hsa-miR-3065-5p	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT2181626	hsa-miR-767-5p	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT2485178	hsa-miR-197	CLIP-seq
MIRT2485179	hsa-miR-204	CLIP-seq
MIRT2485180	hsa-miR-211	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT2485181	hsa-miR-330-3p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT2485182	hsa-miR-3942-3p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT2485183	hsa-miR-4755-5p	CLIP-seq
MIRT2485184	hsa-miR-4771	CLIP-seq
MIRT2485185	hsa-miR-4780	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT2485186	hsa-miR-4803	CLIP-seq
MIRT2485187	hsa-miR-623	CLIP-seq
MIRT2485178	hsa-miR-197	CLIP-seq
MIRT2485179	hsa-miR-204	CLIP-seq
MIRT2485180	hsa-miR-211	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT2485182	hsa-miR-3942-3p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT2485183	hsa-miR-4755-5p	CLIP-seq
MIRT2485185	hsa-miR-4780	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT2485186	hsa-miR-4803	CLIP-seq
MIRT2485187	hsa-miR-623	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
NFKB1	Activation	12010810;15756023
NFKB1	Repression	18566231
NFKB1	Unknown	12687011;15050749;16453001;17673602;20103608
RELA	Activation	12010810;15756023
RELA	Repression	18566231
RELA	Unknown	12687011;15050749;16453001;17673602;20103608

Show/Hide all (84)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	11907583
GO:0001666	Process	Response to hypoxia	IEA
GO:0001741	Component	XY body	IEA
GO:0001890	Process	Placenta development	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	21653699
GO:0004842	Function	Ubiquitin-protein transferase activity	EXP	10797013
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	11907583, 21931591
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005515	Function	Protein binding	IPI	11084335, 11583623, 11907583, 15665297, 16189514, 16282325, 18846110, 19153467, 20447407, 20562859, 21516116, 21525013, 21653699, 21849505, 21931591, 21988832, 22117219, 23524849, 25241761, 25416956, 25486457, 25910212, 28514442, 30561431, 31515488, 31617661, 32296183, 32814053, 339
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15665297, 16510124, 18239673
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16510124, 18239673
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	8548810
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	TAS
GO:0008270	Function	Zinc ion binding	IDA	19153467, 20447407
GO:0008270	Function	Zinc ion binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0016740	Function	Transferase activity	EXP	19008929
GO:0016740	Function	Transferase activity	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IBA
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IEA
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	TAS	20888210
GO:0035631	Component	CD40 receptor complex	IEA
GO:0035631	Component	CD40 receptor complex	ISS
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	TAS	20651737
GO:0039535	Process	Regulation of RIG-I signaling pathway	IEA
GO:0039535	Process	Regulation of RIG-I signaling pathway	TAS	20888210
GO:0042127	Process	Regulation of cell population proliferation	TAS	18414036
GO:0042802	Function	Identical protein binding	IPI	22493164, 25383668, 30561431, 31515488
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IMP	21737330
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	21525013
GO:0043066	Process	Negative regulation of apoptotic process	TAS	20651737
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043130	Function	Ubiquitin binding	IDA	16510124
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	11907583
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045088	Process	Regulation of innate immune response	TAS	21447281
GO:0045471	Process	Response to ethanol	IEA
GO:0045595	Process	Regulation of cell differentiation	TAS	18414036
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	TAS	21447281
GO:0051087	Function	Protein-folding chaperone binding	IPI	18239673
GO:0051591	Process	Response to cAMP	IEA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IDA	15665297
GO:0060544	Process	Regulation of necroptotic process	IEA
GO:0060544	Process	Regulation of necroptotic process	IMP	21737330
GO:0060544	Process	Regulation of necroptotic process	TAS
GO:0060546	Process	Negative regulation of necroptotic process	IBA
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070266	Process	Necroptotic process	IEA
GO:0070424	Process	Regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	IEA
GO:0070424	Process	Regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	TAS	20888210
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0098770	Function	FBXO family protein binding	IPI	16510124
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1902443	Process	Negative regulation of ripoptosome assembly involved in necroptotic process	IEA
GO:1902523	Process	Positive regulation of protein K63-linked ubiquitination	IDA	21931591
GO:1902524	Process	Positive regulation of protein K48-linked ubiquitination	IDA	21931591
GO:1902527	Process	Positive regulation of protein monoubiquitination	IDA	21931591
GO:1902916	Process	Positive regulation of protein polyubiquitination	IEA
GO:1904975	Process	Response to bleomycin	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
601712	590	ENSG00000110330

Q13490

Protein name

Baculoviral IAP repeat-containing protein 2 (EC 2.3.2.27) (Cellular inhibitor of apoptosis 1) (C-IAP1) (IAP homolog B) (Inhibitor of apoptosis protein 2) (hIAP-2) (hIAP2) (RING finger protein 48) (RING-type E3 ubiquitin transferase BIRC2) (TNFR2-TRAF-sign

Protein function

Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling, and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquiti

PDB

1QBH , 2L9M , 3D9T , 3D9U , 3M1D , 3MUP , 3OZ1 , 3T6P , 3UW4 , 4EB9 , 4HY4 , 4HY5 , 4KMN , 4LGE , 4LGU , 4MTI , 4MU7 , 5M6N , 6EXW , 6HPR , 6W74 , 6W7O , 6W8I , 7QGJ , 7TRL , 7TRM , 8DSF , 8DSO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00653	BIR	49 → 114	Inhibitor of Apoptosis domain	Domain
PF00653	BIR	187 → 251	Inhibitor of Apoptosis domain	Domain
PF00653	BIR	272 → 337	Inhibitor of Apoptosis domain	Domain
PF00619	CARD	458 → 542	Caspase recruitment domain	Domain
PF13920	zf-C3HC4_3	567 → 612		Domain

Tissue specificity

TISSUE SPECIFICITY: Present in many fetal and adult tissues. Mainly expressed in adult skeletal muscle, thymus, testis, ovary, and pancreas, low or absent in brain and peripheral blood leukocytes.

Sequence

MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS

Sequence length

618

Interactions

View interactions

	KEGG		Reactome
	Platinum drug resistance NF-kappa B signaling pathway Ubiquitin mediated proteolysis Apoptosis Apoptosis - multiple species Necroptosis Hippo signaling pathway Focal adhesion NOD-like receptor signaling pathway TNF signaling pathway Salmonella infection Toxoplasmosis Herpes simplex virus 1 infection Pathways in cancer Transcriptional misregulation in cancer Small cell lung cancer		Apoptotic cleavage of cellular proteins NOD1/2 Signaling Pathway TICAM1, RIP1-mediated IKK complex recruitment RIPK1-mediated regulated necrosis Regulation of TNFR1 signaling TNFR1-induced NFkappaB signaling pathway TNFR2 non-canonical NF-kB pathway Regulation of necroptotic cell death TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway Ub-specific processing proteases IKK complex recruitment mediated by RIP1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIRC2-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thalidomide response	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (147)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22591684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22591684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29984917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	18955046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39396083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17711515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	17711515		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31512195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	18955046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27534557, 37904685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27304223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	11382748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11382748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31049403		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16983704		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25310109, 27556459, 28849082, 30218457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24422988, 25033461, 26011589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19563669, 24359639, 25033461, 31217499	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	16983704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	26799286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12384799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18082613	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15892165, 22733500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18230607, 20825417, 20951133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12651874, 24261825, 31766357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	16775116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30670910	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21081903		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12208731, 16504151, 22733500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	16504151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22591684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29984917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30400387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	15183896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23201402, 28978315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27827395, 31289894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27827395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28849082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30834598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	37098514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28647349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28855812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12888921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24382102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	26094954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18230607, 20825417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	37140617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34997070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	31816405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27637083, 30902881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31957840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	24345872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30421089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	30421089, 34997070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	14647439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	27282269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	16761316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28422189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30018081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28647349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30257699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	17972100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	15050749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11071269	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	CTD_human_DG	12970779		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	25079338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24526787, 30970518, 31831875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25079338, 31434075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	19564891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16843259, 24976294, 29381806, 29962003, 30459627, 31367251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12243753, 12651874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18230607, 20825417, 24261825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29167558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16156855, 16983704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30393585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30421089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	18032822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24422988, 25033461, 26011589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30902881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12651874, 24261825, 31766357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21081903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16775116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19549337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	14647439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10815900, 11559525, 12208731, 16504151, 20825417, 22285185, 24704827, 25069048, 26094954, 27469115, 29431638, 30181285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16504151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	27537345, 29984917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29984917		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17168540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33399091, 34638912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11090634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16929535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17692804, 17692805, 24987674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20053756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18566024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18566024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	23184147		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15380346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	23184147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18798303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10815900, 11559525, 12208731, 12384799, 16504151, 16814713, 17154176, 18327814, 20068047, 21484931, 22733500, 26498689, 31015310, 31367251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus, Type I	Nephrogenic Diabetes Insipidus	BEFREE	29650969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25033461		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29885057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24008361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25113061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19276372, 29061790		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16775178		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21081903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26168135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16775116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16036106, 30670910, 32186702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	16127431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25635055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	22591684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19549337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	20078866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19549337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17343577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17154176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	31115498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24704827, 27966453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30834598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11559525, 12208731, 15911110, 22733500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15911110, 18621506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20825417, 28050781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30421089, 34997070, 35985688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30421089, 31015310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	14647439		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16080516		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	25635055, 26811494	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29249938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26733177, 29674627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26733177, 27272773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16907856, 17972100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33452764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16775116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16504151	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18230607, 20825417, 38307027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	16983704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BIRC2 (baculoviral IAP repeat containing 2)