HSD3B2 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2)

Gene

• Entrez ID: 3284
• Gene name: Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
• Gene symbol: HSD3B2
• Synonyms (NCBI Gene): HSD3B, HSDB, SDR11E2
• Chromosome: 1
• Chromosome location: 1p12
• Summary: The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28934880	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs80358216	G>A	Pathogenic	Coding sequence variant, stop gained
rs80358218	A>C,G	Pathogenic	Terminator codon variant, stop lost
rs80358219	G>A,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs80358220	C>A,G	Pathogenic	Missense variant, coding sequence variant
rs80358221	C>T	Pathogenic	Missense variant, coding sequence variant
rs121964896	GT>AA	Pathogenic	Missense variant, coding sequence variant
rs121964897	C>T	Pathogenic	Missense variant, coding sequence variant
rs148200568	C>A,T	Pathogenic	Stop gained, synonymous variant, coding sequence variant
rs754609778	AA>-	Pathogenic	Frameshift variant, coding sequence variant
rs767128094	G>A	Likely-pathogenic	Stop gained, coding sequence variant
rs767167623	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs770815049	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1570822744	T>-	Likely-pathogenic	Coding sequence variant, stop gained
rs1570823863	G>A	Likely-pathogenic	Coding sequence variant, stop gained

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018040	hsa-miR-335-5p	Microarray	18185580
MIRT1055497	hsa-miR-1197	CLIP-seq
MIRT1055498	hsa-miR-3117-3p	CLIP-seq
MIRT2245066	hsa-miR-1286	CLIP-seq
MIRT2245067	hsa-miR-1827	CLIP-seq
MIRT2245068	hsa-miR-214	CLIP-seq
MIRT2245069	hsa-miR-3619-5p	CLIP-seq
MIRT2245070	hsa-miR-3661	CLIP-seq
MIRT2245071	hsa-miR-4311	CLIP-seq
MIRT2245072	hsa-miR-492	CLIP-seq
MIRT2245073	hsa-miR-631	CLIP-seq
MIRT2245074	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ENO1	Unknown	15642786
NR1H4	Unknown	19059462
NR4A1	Activation	15666793
NR4A1	Unknown	15208301;20083153;23874725
NR5A1	Activation	19022561
NR5A2	Activation	19022561
NR5A2	Unknown	23874725
SF1	Unknown	23874725
STAT6	Activation	15632317
YY1	Activation	15291746

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0003854	Function	3-beta-hydroxy-Delta5-steroid dehydrogenase (NAD+) activity	IDA	1944309
GO:0003854	Function	3-beta-hydroxy-Delta5-steroid dehydrogenase (NAD+) activity	IEA
GO:0003854	Function	3-beta-hydroxy-Delta5-steroid dehydrogenase (NAD+) activity	IMP	25322271
GO:0004769	Function	Steroid Delta-isomerase activity	IDA	1944309
GO:0004769	Function	Steroid Delta-isomerase activity	IEA
GO:0004769	Function	Steroid Delta-isomerase activity	IMP	25322271
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005758	Component	Mitochondrial intermembrane space	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	IMP	25322271
GO:0005783	Component	Endoplasmic reticulum	NAS	1944309
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005929	Component	Cilium	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IBA
GO:0006694	Process	Steroid biosynthetic process	IDA	1944309
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IMP	25322271
GO:0006702	Process	Androgen biosynthetic process	IEA
GO:0006702	Process	Androgen biosynthetic process	IMP	25322271
GO:0008207	Process	C21-steroid hormone metabolic process	IBA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	1944309
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0030868	Component	Smooth endoplasmic reticulum membrane	ISS
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031966	Component	Mitochondrial membrane	NAS	1944309
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045171	Component	Intercellular bridge	IEA

Other IDs

• MIM: 613890
• HGNC: 5218
• e!Ensembl: ENSG00000203859

Protein

• UniProt ID: P26439
• Protein name: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II) (3-beta-HSD II) (3-beta-HSD adrenal and gonadal type) [Includes: 3-beta-hydroxy-Delta(5)-steroid dehydrogenase (EC 1.1.1.1
• Protein function: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all cl
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01073	3Beta_HSD	6 → 287	3-beta hydroxysteroid dehydrogenase/isomerase family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in adrenal gland, testis and ovary.
• Sequence:

  MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEG
  DILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI
  YTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLY
  TCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR
  DPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVV
  SFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV
  DRHKETLKSKTQ

• Sequence length: 372

Pathways

KEGG:

Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Aldosterone synthesis and secretion
Cortisol synthesis and secretion
Cushing syndrome

Reactome:

Androgen biosynthesis
Mineralocorticoid biosynthesis
Glucocorticoid biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
3 beta-Hydroxysteroid dehydrogenase deficiency	Pathogenic; Likely pathogenic	rs766474996, rs757033996, rs756663759, rs756607591, rs2101350289, rs1266831898, rs1651905495, rs80358216, rs770815049, rs80358217, rs28934880, rs80358218, rs80358219, rs80358220, rs80358221, rs767167623, rs121964897, rs2526391147, rs2526391280, rs2526392619, rs1651911095, rs1399005702, rs760846678, rs767128094, rs754609778, rs148200568, rs765335418, rs762479018, rs781213951, rs905880501	RCV001831404 RCV001836390 RCV001782270 RCV005008420 RCV005006306 RCV003464287 RCV003237406 RCV000012967 RCV000012968 RCV001275503 RCV000012971 RCV000012972 RCV000012973 RCV000012974 RCV000012975 RCV000012976 RCV000012977 RCV005012933 RCV003459900 RCV003459912 RCV003459923 RCV005013027 RCV005013056 RCV005003726 RCV000603955 RCV003460995 RCV001830636 RCV001580573 RCV001536075 RCV001833816 RCV001833981	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital adrenal hyperplasia	Pathogenic; Likely pathogenic	rs756607591, rs1388517943, rs2526391378, rs765547422, rs2526393548, rs80358217, rs80358220, rs80358221, rs1248094870, rs767128094, rs754609778, rs762479018, rs781213951	RCV005406272 RCV005432872 RCV002281875 RCV002302451 RCV002302452 RCV004767003 RCV002271368 RCV002222349 RCV003324316 RCV002298708 RCV002469276 RCV001806054 RCV003486965	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
HSD3B2-related disorder	Likely pathogenic; Pathogenic	rs2526391147, rs762479018, rs781213951	RCV003410454 RCV004754704 RCV003405390	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypospadias 1, X-linked	Likely pathogenic	rs2101349426	RCV003110130	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ADRENAL HYPERPLASIA DUE TO 3-BETA-HYDROXYSTEROID DEHYDROGENASE DEFICIENCY	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYPTORCHIDISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ependymoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARANOIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARANOID DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
3 beta-Hydroxysteroid dehydrogenase deficiency	3 beta-hydroxysteroid dehydrogenase deficiency	UNIPROT_DG	10599696, 10651755, 10843183, 12050213, 18252794, 22579964, 7608265, 7633426, 7633460, 7833923, 7893703, 7962268, 8060486, 8126127, 8185809, 8316254, 9719627		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
3 beta-Hydroxysteroid dehydrogenase deficiency	3 beta-hydroxysteroid dehydrogenase deficiency	BEFREE	10651755, 10843183, 12428206, 15585552, 18252794, 22343390, 25211449, 26079780		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
3 beta-Hydroxysteroid dehydrogenase deficiency	3 beta-hydroxysteroid dehydrogenase deficiency	CLINVAR_DG	18252794		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
3 beta-Hydroxysteroid dehydrogenase deficiency	3 beta-hydroxysteroid dehydrogenase deficiency	CTD_human_DG	25526675		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
3 beta-Hydroxysteroid dehydrogenase deficiency	3 beta-hydroxysteroid dehydrogenase deficiency	ORPHANET_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
3 beta-Hydroxysteroid dehydrogenase deficiency	3 beta-hydroxysteroid dehydrogenase deficiency	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Abdominal Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★☆☆☆☆ Found in Text Mining only
Acne	Acne	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	LHGDN	18505908		★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia	Adrenal hyperplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia 2	Adrenal Hyperplasia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	27626911, 27796263, 32072793, 33757164, 36553457, 37274334	Associate	★☆☆☆☆ Found in Text Mining only
Adrenogenital Syndrome	Adrenogenital Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	BEFREE	15585552, 21340167, 27082427		★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ambiguous genitalia, female	Ambiguous Genitalia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	33024080	Inhibit	★☆☆☆☆ Found in Text Mining only
Bilateral Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23284679		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23284679	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23284679		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38001042	Associate	★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	10843183, 11196452, 12428206, 12608938, 21340167, 22343390, 26079780, 27082427, 27626911, 8004103		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	CTD_human_DG	18252794		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	HPO_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	17496421, 22343390, 26079780		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 3-beta-hydroxysteroid dehydrogenase deficiency	Congenital adrenal hyperplasia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conn Adenoma	Conn Adenoma	BEFREE	25458695, 30580688		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	21801737, 28863887		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	38001042	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cryptorchidism	Cryptorchidism	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deficiency of testosterone biosynthesis	Deficiency Of Testosterone Biosynthesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ectopic adrenal gland	Ectopic adrenal gland	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23200943		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	19022561		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25137424		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29664547	Associate	★☆☆☆☆ Found in Text Mining only
Enlarged polycystic ovaries	Enlarged polycystic ovaries	HPO_DG			★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	20660004		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	23257735, 24423300, 25458695, 30580688	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	11287026	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	30650063		★☆☆☆☆ Found in Text Mining only
Hypernatriuria	Hypernatriuria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophy of clitoris	Hypertrophy Of Clitoris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoaldosteronism	Hypoaldosteronism	BEFREE	27626911		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	LHGDN	14764821		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	CTD_human_DG	14764821		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	BEFREE	25605705		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	Pubtator	33757164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias, perineal	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	35757411	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	20660004		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28589964		★☆☆☆☆ Found in Text Mining only
Male Pseudohermaphroditism	Male Pseudohermaphroditism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23200943		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11912155, 17823934, 19505920, 29369461, 29803408, 9294620		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17823934		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23284679		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	21570127, 22356824		★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28391539, 32590918	Associate	★☆☆☆☆ Found in Text Mining only
Paranoia	Paranoia	CTD_human_DG	22356824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Penile hypospadias	Penile Hypospadias	BEFREE	25605705		★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	22381227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	23874725, 26465200, 30650063, 31276164		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	23874725, 29206944, 35757411	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38069013	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precocious pubarche	Precocious Pubarche	BEFREE	10651755, 11287026, 15585552, 8185809		★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	HPO_DG			★☆☆☆☆ Found in Text Mining only
Premature adrenarche	Premature adrenarche	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11912155, 17823934, 19505920, 29369461, 29803408, 9294620		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17823934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17823934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17823934, 23258647, 33509203	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	22381227		★☆☆☆☆ Found in Text Mining only
Unilateral Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23284679	Associate	★☆☆☆☆ Found in Text Mining only