HRH2 (histamine receptor H2)

Gene

• Entrez ID: 3274
• Gene name: Histamine receptor H2
• Gene symbol: HRH2
• Synonyms (NCBI Gene): H2R, HH2R
• Chromosome: 5
• Chromosome location: 5q35.2
• Summary: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. Histamine receptor H2 belongs to the family 1 of G protein-coupled

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016874	hsa-miR-335-5p	Microarray	18185580
MIRT409766	hsa-miR-3940-3p	PAR-CLIP	20371350
MIRT560290	hsa-miR-4476	PAR-CLIP	20371350
MIRT560289	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT560287	hsa-miR-9500	PAR-CLIP	20371350
MIRT560288	hsa-miR-5697	PAR-CLIP	20371350
MIRT409768	hsa-miR-4783-3p	PAR-CLIP	20371350
MIRT560286	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT560285	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT560284	hsa-miR-4419a	PAR-CLIP	20371350
MIRT560283	hsa-miR-4510	PAR-CLIP	20371350
MIRT560282	hsa-miR-6127	PAR-CLIP	20371350
MIRT560281	hsa-miR-6129	PAR-CLIP	20371350
MIRT560280	hsa-miR-6130	PAR-CLIP	20371350
MIRT560279	hsa-miR-6133	PAR-CLIP	20371350
MIRT560278	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT409765	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT409767	hsa-miR-4710	PAR-CLIP	20371350
MIRT409769	hsa-miR-8065	PAR-CLIP	20371350
MIRT560277	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT409766	hsa-miR-3940-3p	PAR-CLIP	20371350
MIRT560290	hsa-miR-4476	PAR-CLIP	20371350
MIRT560289	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT560287	hsa-miR-9500	PAR-CLIP	20371350
MIRT560288	hsa-miR-5697	PAR-CLIP	20371350
MIRT409768	hsa-miR-4783-3p	PAR-CLIP	20371350
MIRT560286	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT560285	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT560284	hsa-miR-4419a	PAR-CLIP	20371350
MIRT560283	hsa-miR-4510	PAR-CLIP	20371350
MIRT560282	hsa-miR-6127	PAR-CLIP	20371350
MIRT560281	hsa-miR-6129	PAR-CLIP	20371350
MIRT560280	hsa-miR-6130	PAR-CLIP	20371350
MIRT560279	hsa-miR-6133	PAR-CLIP	20371350
MIRT560278	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT409765	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT409767	hsa-miR-4710	PAR-CLIP	20371350
MIRT409769	hsa-miR-8065	PAR-CLIP	20371350
MIRT560277	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT1054681	hsa-miR-1206	CLIP-seq
MIRT1054682	hsa-miR-1273f	CLIP-seq
MIRT1054683	hsa-miR-2682	CLIP-seq
MIRT1054684	hsa-miR-3152-5p	CLIP-seq
MIRT1054685	hsa-miR-4328	CLIP-seq
MIRT1054686	hsa-miR-449c	CLIP-seq
MIRT1054687	hsa-miR-4774-3p	CLIP-seq
MIRT1054688	hsa-miR-940	CLIP-seq
MIRT2012432	hsa-miR-4269	CLIP-seq
MIRT2012433	hsa-miR-4502	CLIP-seq
MIRT2012434	hsa-miR-4514	CLIP-seq
MIRT2012435	hsa-miR-4692	CLIP-seq
MIRT2012436	hsa-miR-4742-5p	CLIP-seq
MIRT2012437	hsa-miR-526b	CLIP-seq
MIRT2012438	hsa-miR-578	CLIP-seq
MIRT2012439	hsa-miR-627	CLIP-seq
MIRT2012440	hsa-miR-924	CLIP-seq
MIRT2389167	hsa-miR-193a-5p	CLIP-seq
MIRT2389168	hsa-miR-2276	CLIP-seq
MIRT2389169	hsa-miR-3616-3p	CLIP-seq
MIRT2389170	hsa-miR-4527	CLIP-seq
MIRT2012436	hsa-miR-4742-5p	CLIP-seq
MIRT2389171	hsa-miR-4772-3p	CLIP-seq
MIRT2389172	hsa-miR-516b	CLIP-seq
MIRT2389173	hsa-miR-541	CLIP-seq
MIRT2389174	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001696	Process	Gastric acid secretion	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004969	Function	Histamine receptor activity	IBA
GO:0004969	Function	Histamine receptor activity	IEA
GO:0004969	Function	Histamine receptor activity	TAS	9725260
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1714721
GO:0006955	Process	Immune response	TAS	9725260
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	9725260
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0045202	Component	Synapse	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA

Other IDs

• MIM: 142703
• HGNC: 5183
• e!Ensembl: ENSG00000113749

Protein

• UniProt ID: P25021
• Protein name: Histamine H2 receptor (H2R) (HH2R) (Gastric receptor I)
• Protein function: The H2 subclass of histamine receptors mediates gastric acid secretion. Also appears to regulate gastrointestinal motility and intestinal secretion. Possible role in regulating cell growth and differentiation. The activity of this receptor is me
• PDB: 7UL3, 8POK, 8YN3, 8YN4, 8YUT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	35 → 288	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
  AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
  MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
  VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
  GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
  QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

• Sequence length: 359

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gastric acid secretion

Reactome:

Histamine receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY STENOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29049325		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15514212, 29191567		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29191567		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24371118		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25922853, 40425926	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36059531, 37689589, 37781030	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29191567	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	29191567		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16203768, 18258331		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30462522		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36902343	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26989676, 29191567		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	CTD_human_DG	12721106		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystitis Interstitial	Interstitial cystitis	Pubtator	31718622	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36142206	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	25723478	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	28507564		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	22720301	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	16299042	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28456772		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29191567		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29191567	Associate	★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	LHGDN	16888049		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	16299042	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22689678	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22615049		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15848191		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15848191	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30159732		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	18366640	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	12667890		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	12667890		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31278444	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10822343, 9154248		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	21760883		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22615049		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	22720301	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10371214	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	36674940	Associate	★☆☆☆☆ Found in Text Mining only