Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3273
Gene name	Histidine rich glycoprotein
Gene symbol	HRG
Synonyms (NCBI Gene)	HPRGHRGPTHPH11
Chromosome	3
Chromosome location	3q27.3
Summary	This histidine-rich glycoprotein contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions. The encoded protein a

Show/Hide all (11)

miRTarBase ID	miRNA	Experiments
MIRT1054641	hsa-miR-140-5p	CLIP-seq
MIRT1054642	hsa-miR-3133	CLIP-seq
MIRT1054643	hsa-miR-3545-5p	CLIP-seq
MIRT1054644	hsa-miR-4460	CLIP-seq
MIRT1054645	hsa-miR-4511	CLIP-seq
MIRT1054646	hsa-miR-4710	CLIP-seq
MIRT1054647	hsa-miR-4765	CLIP-seq
MIRT1054648	hsa-miR-4792	CLIP-seq
MIRT1054649	hsa-miR-542-3p	CLIP-seq
MIRT1054650	hsa-miR-606	CLIP-seq
MIRT2012430	hsa-miR-4695-3p	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002839	Process	Positive regulation of immune response to tumor cell	IBA
GO:0002839	Process	Positive regulation of immune response to tumor cell	IDA	21215706
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005102	Function	Signaling receptor binding	IDA	16436387
GO:0005515	Function	Protein binding	IPI	11134179, 15220341, 19285951, 19712047, 20561914, 21304106, 21988832, 24825900, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	18797515
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006935	Process	Chemotaxis	IEA
GO:0007162	Process	Negative regulation of cell adhesion	IDA	14744774
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0008201	Function	Heparin binding	IBA
GO:0008201	Function	Heparin binding	IDA	16436387, 21304106
GO:0008201	Function	Heparin binding	IEA
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IDA	15138272, 16436387, 21304106
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	14744774
GO:0009986	Component	Cell surface	IDA	15220341
GO:0010468	Process	Regulation of gene expression	IDA	21215706
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010543	Process	Regulation of platelet activation	IBA
GO:0010543	Process	Regulation of platelet activation	ISS
GO:0010593	Process	Negative regulation of lamellipodium assembly	IDA	16489009
GO:0016525	Process	Negative regulation of angiogenesis	IDA	14744774, 16436387, 16489009, 19903770
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0019865	Function	Immunoglobulin binding	IDA	10514432
GO:0020037	Function	Heme binding	IDA	678554
GO:0030168	Process	Platelet activation	IDA	19903770
GO:0030193	Process	Regulation of blood coagulation	IDA	6740558, 21304106
GO:0030308	Process	Negative regulation of cell growth	IDA	21215706
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28344315, 28675934
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	16489009
GO:0033629	Process	Negative regulation of cell adhesion mediated by integrin	IDA	16489009
GO:0042730	Process	Fibrinolysis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	14744774
GO:0043254	Process	Regulation of protein-containing complex assembly	IDA	16489009
GO:0043395	Function	Heparan sulfate proteoglycan binding	IDA	15138272, 16436387
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	ISS
GO:0046872	Function	Metal ion binding	IDA	678554
GO:0046872	Function	Metal ion binding	IEA
GO:0050730	Process	Regulation of peptidyl-tyrosine phosphorylation	IDA	16489009
GO:0050832	Process	Defense response to fungus	IDA	18797515
GO:0051838	Process	Cytolysis by host of symbiont cells	IDA	18797515
GO:0051894	Process	Positive regulation of focal adhesion assembly	IDA	14744774, 16436387
GO:0051918	Process	Negative regulation of fibrinolysis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	18797515
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IDA	16489009
GO:2000504	Process	Positive regulation of blood vessel remodeling	IDA	21215706
GO:2001027	Process	Negative regulation of endothelial cell chemotaxis	IDA	14744774, 16436387, 16489009

MIM	HGNC	e!Ensembl
142640	5181	ENSG00000113905

P04196

Protein name

Histidine-rich glycoprotein (Histidine-proline-rich glycoprotein) (HPRG)

Protein function

Plasma glycoprotein that binds a number of ligands such as heme, heparin, heparan sulfate, thrombospondin, plasminogen, and divalent metal ions. Binds heparin and heparin/glycosaminoglycans in a zinc-dependent manner. Binds heparan sulfate on th

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00031	Cystatin	18 → 107	Cystatin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in macrophages and in malignant cells. Expressed by the liver and secreted in plasma (at protein level). {ECO:0000269|PubMed:14744774, ECO:0000269|PubMed:19903770, ECO:0000269|PubMed:21215706}.

Sequence

MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDR
VENTTVYYLVLDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLR
VIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRI
ERVARVRGGEGTGYFVDFSVRNCPRHHFPRHPNVFGFCRADLFYDVEALDLESPKNLVIN
CEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKPHGSRDHHHPHKPHEHGPPPP
PDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLHPHKHHSHEQH
PHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPP
PHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSF
PLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPK

Sequence length

525

Interactions

View interactions

	Reactome
			Platelet degranulation Dissolution of Fibrin Clot

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Familial early-onset deep venous thrombosis	Likely pathogenic; Pathogenic	rs761776963	RCV000509067	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary thrombophilia due to congenital histidine-rich (poly-L) glycoprotein deficiency	Pathogenic; Likely pathogenic	rs121918122, rs761776963	RCV000016049 RCV000627095	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormal bleeding	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HRG-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA DUE TO ELEVATED HISTIDINE-RICH GLYCOPROTEIN	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA DUE TO HISTIDINE-RICH GLYCOPROTEIN DEFICIENCY	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombus	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

HRG (histidine rich glycoprotein)