Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3249
Gene name	Hepsin
Gene symbol	HPN
Synonyms (NCBI Gene)	TMPRSS1
Chromosome	19
Chromosome location	19q13.11
Summary	This gene encodes a type II transmembrane serine protease that may be involved in diverse cellular functions, including blood coagulation and the maintenance of cell morphology. Expression of the encoded protein is associated with the growth and progressi

Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004197	hsa-miR-197-3p	Microarray	16822819
MIRT2451360	hsa-miR-3190	CLIP-seq
MIRT2451361	hsa-miR-4252	CLIP-seq
MIRT2451362	hsa-miR-4258	CLIP-seq
MIRT2451363	hsa-miR-4308	CLIP-seq
MIRT2451364	hsa-miR-4318	CLIP-seq
MIRT2451365	hsa-miR-4707-3p	CLIP-seq
MIRT2451366	hsa-miR-4725-5p	CLIP-seq
MIRT2451367	hsa-miR-4751	CLIP-seq
MIRT2451368	hsa-miR-504	CLIP-seq
MIRT2451369	hsa-miR-7	CLIP-seq
MIRT2547512	hsa-miR-1323	CLIP-seq
MIRT2547513	hsa-miR-4795-3p	CLIP-seq
MIRT2547514	hsa-miR-548aa	CLIP-seq
MIRT2547515	hsa-miR-548o	CLIP-seq
MIRT2547512	hsa-miR-1323	CLIP-seq
MIRT2547513	hsa-miR-4795-3p	CLIP-seq
MIRT2547514	hsa-miR-548aa	CLIP-seq
MIRT2547515	hsa-miR-548o	CLIP-seq

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IDA	16908524
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	15614436, 19911255, 32296183
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	17918732
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1885621, 8346233
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	ISS
GO:0006508	Process	Proteolysis	IDA	16908524, 19843851, 19911255, 24227843
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IDA	16908524, 19843851
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IDA	19911255
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	1885621
GO:0008360	Process	Regulation of cell shape	IMP	8346233
GO:0009986	Component	Cell surface	IDA	8346233, 16908524
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	19843851
GO:0010756	Process	Positive regulation of plasminogen activation	IDA	16908524
GO:0016020	Component	Membrane	IDA	19843851
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016485	Process	Protein processing	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	8346233
GO:0031965	Component	Nuclear membrane	IDA	15614436
GO:0034769	Process	Basement membrane disassembly	IDA	16908524
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15614436
GO:0043923	Process	Host-mediated activation of viral transcription	IDA	15614436
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	19843851
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	ISS
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070008	Function	Serine-type exopeptidase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0090103	Process	Cochlea morphogenesis	ISS
GO:0097066	Process	Response to thyroid hormone	ISS
GO:0097195	Process	Pilomotor reflex	ISS
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IDA	15614436
GO:2000611	Process	Positive regulation of thyroid hormone generation	ISS

MIM	HGNC	e!Ensembl
142440	5155	ENSG00000105707

P05981

Protein name

Serine protease hepsin (EC 3.4.21.106) (Transmembrane protease serine 1) [Cleaved into: Serine protease hepsin non-catalytic chain; Serine protease hepsin catalytic chain]

Protein function

Serine protease that cleaves extracellular substrates, and contributes to the proteolytic processing of growth factors, such as HGF and MST1/HGFL (PubMed:15839837, PubMed:21875933). Plays a role in cell growth and maintenance of cell morphology

PDB

1O5E , 1O5F , 1P57 , 1Z8G , 3T2N , 5CE1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09272	Hepsin-SRCR	50 → 159	Hepsin, SRCR domain	Domain
PF00089	Trypsin	163 → 400	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in liver and kidney. {ECO:0000269|PubMed:21875933}.

Sequence

MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

Sequence length

417

Interactions

View interactions

	KEGG		Reactome
	Viral carcinogenesis		MET Receptor Activation Signaling by MST1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPIDOSES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (52)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	18338334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	18487557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11406537, 14665873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28886448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15583422, 26014348, 26165838, 29211761, 30227221, 30372442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25029565, 26014348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15839837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17346539, 9230195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35164791	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17309599	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19148468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28693148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30115461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29196708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	31511532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	31511532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18698500, 26990747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	26990747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18383840	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28792647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	29701962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	26645624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	21875933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	18487557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoidosis	Lipoidosis	CTD_human_DG	15342952, 16919414		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	16585186, 16911458, 2835076, 28523650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26760961, 2835076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18383840	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26014348, 26165838, 29211761, 30227221, 30372442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	18698500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19148468, 9230195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11479199, 11518967, 12460890, 12629351, 12949937, 14665873, 15324701, 15539945, 16585186, 16783571, 17569629, 18381435, 18784072, 19843851, 20166135 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15583422, 16783571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27841306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12172426, 18338334, 21875933, 29218249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesenteric vascular insufficiency	Mesenteric Vascular Insufficiency	BEFREE	30115461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	21750652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14665873, 15645116, 16585186, 18784072, 19843851, 21750652, 22665141, 26990747, 28693148, 9230195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	18383840	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19148468, 9230195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15839837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11479199, 11518967, 12460890, 12629351, 12949937, 14665873, 15324701, 15539945, 16585186, 16783571, 17569629, 18381435, 18784072, 19843851, 20166135 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	37781794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11518967, 12057920, 15928670, 20037200, 20166135, 20441232, 33032611, 37781794	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12172426, 16585186, 18784072, 19843851		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12629351, 15792801, 16783571, 18784072		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15583422, 16783571		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35484884	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16585186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27841306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27841306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	29196708		★★★★★ ★☆☆☆☆ Found in Text Mining only

HPN (hepsin)