Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	3241
Gene name	Hippocalcin like 1
Gene symbol	HPCAL1
Synonyms (NCBI Gene)	BDR1HLP2VILIP-3
Chromosome	2
Chromosome location	2p25.1
Summary	The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may

184

Show/Hide all (184)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025893	hsa-miR-7-5p	Microarray	19073608
MIRT487669	hsa-miR-2278	PAR-CLIP	20371350
MIRT487668	hsa-miR-6165	PAR-CLIP	20371350
MIRT487667	hsa-miR-4747-3p	PAR-CLIP	20371350
MIRT487662	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT487666	hsa-miR-1247-3p	PAR-CLIP	20371350
MIRT487665	hsa-miR-4532	PAR-CLIP	20371350
MIRT487664	hsa-miR-6784-5p	PAR-CLIP	20371350
MIRT487663	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT487662	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT487661	hsa-miR-1538	PAR-CLIP	20371350
MIRT487660	hsa-miR-4745-3p	PAR-CLIP	20371350
MIRT487659	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT487658	hsa-miR-8085	PAR-CLIP	20371350
MIRT487657	hsa-miR-3976	PAR-CLIP	20371350
MIRT487669	hsa-miR-2278	PAR-CLIP	23592263
MIRT487668	hsa-miR-6165	PAR-CLIP	23592263
MIRT487667	hsa-miR-4747-3p	PAR-CLIP	23592263
MIRT487662	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT487666	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT487665	hsa-miR-4532	PAR-CLIP	23592263
MIRT487664	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT487663	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT487662	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT487661	hsa-miR-1538	PAR-CLIP	23592263
MIRT487660	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT487659	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT487658	hsa-miR-8085	PAR-CLIP	23592263
MIRT487657	hsa-miR-3976	PAR-CLIP	23592263
MIRT487666	hsa-miR-1247-3p	PAR-CLIP	26701625
MIRT487661	hsa-miR-1538	PAR-CLIP	26701625
MIRT487669	hsa-miR-2278	PAR-CLIP	26701625
MIRT487657	hsa-miR-3976	PAR-CLIP	26701625
MIRT487665	hsa-miR-4532	PAR-CLIP	26701625
MIRT487660	hsa-miR-4745-3p	PAR-CLIP	26701625
MIRT487667	hsa-miR-4747-3p	PAR-CLIP	26701625
MIRT487668	hsa-miR-6165	PAR-CLIP	26701625
MIRT487659	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT487663	hsa-miR-6746-5p	PAR-CLIP	26701625
MIRT487664	hsa-miR-6784-5p	PAR-CLIP	26701625
MIRT487658	hsa-miR-8085	PAR-CLIP	26701625
MIRT487662	hsa-miR-873-5p	PAR-CLIP	26701625
MIRT487669	hsa-miR-2278	PAR-CLIP	20371350
MIRT487668	hsa-miR-6165	PAR-CLIP	20371350
MIRT487667	hsa-miR-4747-3p	PAR-CLIP	20371350
MIRT487662	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT487666	hsa-miR-1247-3p	PAR-CLIP	20371350
MIRT487665	hsa-miR-4532	PAR-CLIP	20371350
MIRT487664	hsa-miR-6784-5p	PAR-CLIP	20371350
MIRT487663	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT487662	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT487661	hsa-miR-1538	PAR-CLIP	20371350
MIRT487660	hsa-miR-4745-3p	PAR-CLIP	20371350
MIRT487659	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT487658	hsa-miR-8085	PAR-CLIP	20371350
MIRT487657	hsa-miR-3976	PAR-CLIP	20371350
MIRT487669	hsa-miR-2278	PAR-CLIP	23592263
MIRT487668	hsa-miR-6165	PAR-CLIP	23592263
MIRT487667	hsa-miR-4747-3p	PAR-CLIP	23592263
MIRT487662	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT487666	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT487665	hsa-miR-4532	PAR-CLIP	23592263
MIRT487664	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT487663	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT487662	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT487661	hsa-miR-1538	PAR-CLIP	23592263
MIRT487660	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT487659	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT487658	hsa-miR-8085	PAR-CLIP	23592263
MIRT487657	hsa-miR-3976	PAR-CLIP	23592263
MIRT1053988	hsa-miR-553	CLIP-seq
MIRT1053989	hsa-miR-873	CLIP-seq
MIRT1053990	hsa-miR-1	CLIP-seq
MIRT1053991	hsa-miR-1254	CLIP-seq
MIRT1053992	hsa-miR-1266	CLIP-seq
MIRT1053993	hsa-miR-197	CLIP-seq
MIRT1053994	hsa-miR-206	CLIP-seq
MIRT1053995	hsa-miR-24	CLIP-seq
MIRT1053996	hsa-miR-2682	CLIP-seq
MIRT1053997	hsa-miR-3116	CLIP-seq
MIRT1053998	hsa-miR-3127-5p	CLIP-seq
MIRT1053999	hsa-miR-3165	CLIP-seq
MIRT1054000	hsa-miR-3166	CLIP-seq
MIRT1054001	hsa-miR-3177-3p	CLIP-seq
MIRT1054002	hsa-miR-3184	CLIP-seq
MIRT1054003	hsa-miR-339-5p	CLIP-seq
MIRT1054004	hsa-miR-3646	CLIP-seq
MIRT1054005	hsa-miR-3662	CLIP-seq
MIRT1054006	hsa-miR-3689a-3p	CLIP-seq
MIRT1054007	hsa-miR-3689c	CLIP-seq
MIRT1054008	hsa-miR-3689d	CLIP-seq
MIRT1054009	hsa-miR-3714	CLIP-seq
MIRT1054010	hsa-miR-3918	CLIP-seq
MIRT1054011	hsa-miR-3934	CLIP-seq
MIRT1054012	hsa-miR-423-5p	CLIP-seq
MIRT1054013	hsa-miR-4257	CLIP-seq
MIRT1054014	hsa-miR-4283	CLIP-seq
MIRT1054015	hsa-miR-4311	CLIP-seq
MIRT1054016	hsa-miR-4434	CLIP-seq
MIRT1054017	hsa-miR-449c	CLIP-seq
MIRT1054018	hsa-miR-4514	CLIP-seq
MIRT1054019	hsa-miR-4516	CLIP-seq
MIRT1054020	hsa-miR-4518	CLIP-seq
MIRT1054021	hsa-miR-4531	CLIP-seq
MIRT1054022	hsa-miR-4537	CLIP-seq
MIRT1054023	hsa-miR-4643	CLIP-seq
MIRT1054024	hsa-miR-4681	CLIP-seq
MIRT1054025	hsa-miR-4692	CLIP-seq
MIRT1054026	hsa-miR-4706	CLIP-seq
MIRT1054027	hsa-miR-4728-5p	CLIP-seq
MIRT1054028	hsa-miR-4729	CLIP-seq
MIRT1054029	hsa-miR-4749-5p	CLIP-seq
MIRT1054030	hsa-miR-486-3p	CLIP-seq
MIRT1054031	hsa-miR-548an	CLIP-seq
MIRT1054032	hsa-miR-550a	CLIP-seq
MIRT1054033	hsa-miR-586	CLIP-seq
MIRT1054034	hsa-miR-613	CLIP-seq
MIRT1054035	hsa-miR-661	CLIP-seq
MIRT1054036	hsa-miR-744	CLIP-seq
MIRT1053989	hsa-miR-873	CLIP-seq
MIRT1054037	hsa-miR-887	CLIP-seq
MIRT1053991	hsa-miR-1254	CLIP-seq
MIRT1053997	hsa-miR-3116	CLIP-seq
MIRT1054001	hsa-miR-3177-3p	CLIP-seq
MIRT1054002	hsa-miR-3184	CLIP-seq
MIRT1054003	hsa-miR-339-5p	CLIP-seq
MIRT2012249	hsa-miR-3912	CLIP-seq
MIRT1054012	hsa-miR-423-5p	CLIP-seq
MIRT1054014	hsa-miR-4283	CLIP-seq
MIRT2012250	hsa-miR-4722-3p	CLIP-seq
MIRT1054027	hsa-miR-4728-5p	CLIP-seq
MIRT2012251	hsa-miR-4731-3p	CLIP-seq
MIRT2012252	hsa-miR-4801	CLIP-seq
MIRT1054035	hsa-miR-661	CLIP-seq
MIRT1053990	hsa-miR-1	CLIP-seq
MIRT2244636	hsa-miR-105	CLIP-seq
MIRT1053991	hsa-miR-1254	CLIP-seq
MIRT1053992	hsa-miR-1266	CLIP-seq
MIRT1053993	hsa-miR-197	CLIP-seq
MIRT1053994	hsa-miR-206	CLIP-seq
MIRT1053995	hsa-miR-24	CLIP-seq
MIRT1053996	hsa-miR-2682	CLIP-seq
MIRT1053997	hsa-miR-3116	CLIP-seq
MIRT1053998	hsa-miR-3127-5p	CLIP-seq
MIRT1054000	hsa-miR-3166	CLIP-seq
MIRT1054002	hsa-miR-3184	CLIP-seq
MIRT1054009	hsa-miR-3714	CLIP-seq
MIRT1054010	hsa-miR-3918	CLIP-seq
MIRT2244637	hsa-miR-421	CLIP-seq
MIRT1054012	hsa-miR-423-5p	CLIP-seq
MIRT1054013	hsa-miR-4257	CLIP-seq
MIRT2244638	hsa-miR-4270	CLIP-seq
MIRT1054015	hsa-miR-4311	CLIP-seq
MIRT2244639	hsa-miR-4441	CLIP-seq
MIRT1054017	hsa-miR-449c	CLIP-seq
MIRT1054018	hsa-miR-4514	CLIP-seq
MIRT1054020	hsa-miR-4518	CLIP-seq
MIRT1054025	hsa-miR-4692	CLIP-seq
MIRT2244640	hsa-miR-4709-5p	CLIP-seq
MIRT2244641	hsa-miR-4719	CLIP-seq
MIRT2012250	hsa-miR-4722-3p	CLIP-seq
MIRT2012251	hsa-miR-4731-3p	CLIP-seq
MIRT2012252	hsa-miR-4801	CLIP-seq
MIRT1054031	hsa-miR-548an	CLIP-seq
MIRT1054033	hsa-miR-586	CLIP-seq
MIRT1054034	hsa-miR-613	CLIP-seq
MIRT1054035	hsa-miR-661	CLIP-seq
MIRT1054000	hsa-miR-3166	CLIP-seq
MIRT1054015	hsa-miR-4311	CLIP-seq
MIRT1054018	hsa-miR-4514	CLIP-seq
MIRT1054023	hsa-miR-4643	CLIP-seq
MIRT1054025	hsa-miR-4692	CLIP-seq
MIRT1054033	hsa-miR-586	CLIP-seq
MIRT1053993	hsa-miR-197	CLIP-seq
MIRT2429704	hsa-miR-412	CLIP-seq
MIRT2429705	hsa-miR-4436b-5p	CLIP-seq
MIRT2012251	hsa-miR-4731-3p	CLIP-seq
MIRT2012252	hsa-miR-4801	CLIP-seq
MIRT1054033	hsa-miR-586	CLIP-seq
MIRT1053993	hsa-miR-197	CLIP-seq
MIRT2429704	hsa-miR-412	CLIP-seq
MIRT2429705	hsa-miR-4436b-5p	CLIP-seq
MIRT2012251	hsa-miR-4731-3p	CLIP-seq
MIRT2012252	hsa-miR-4801	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	8038222
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 25416956, 25519916, 28514442, 32296183, 32814053, 33961781
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
600207	5145	ENSG00000115756

P37235

Protein name

Hippocalcin-like protein 1 (Calcium-binding protein BDR-1) (HLP2) (Visinin-like protein 3) (VILIP-3)

Protein function

May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.

PDB

5T7C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13833	EF-hand_8	39 → 90	EF-hand domain pair	Domain
PF13499	EF-hand_7	98 → 174	EF-hand domain pair	Domain
PF00036	EF-hand_1	148 → 176	EF hand	Domain

Sequence

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF

Sequence length

193

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CATARACT 13 WITH ADULT I PHENOTYPE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular endothelial growth factor (VEGF) inhibitor response	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	21059989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	GWASDB_DG	20460270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36617552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35718636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40179422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35645147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation	Congenital Central Hypoventilation	BEFREE	23873030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation syndrome	Congenital central hypoventilation syndrome	Pubtator	23873030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31424985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36360783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30843345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30843345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15834280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37783761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	38064228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29535540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23873030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23873030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23873030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HPCAL1 (hippocalcin like 1)