Gene Gene information from NCBI Gene database.
Entrez ID 3238
Gene name Homeobox D12
Gene symbol HOXD12
Synonyms (NCBI Gene)
HOX4H
Chromosome 2
Chromosome location 2q31.1
Summary This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
84
miRTarBase ID miRNA Experiments Reference
MIRT635171 hsa-miR-3606-3p HITS-CLIP 23824327
MIRT635170 hsa-miR-513a-3p HITS-CLIP 23824327
MIRT635169 hsa-miR-513c-3p HITS-CLIP 23824327
MIRT635168 hsa-miR-495-3p HITS-CLIP 23824327
MIRT635167 hsa-miR-5688 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001501 Process Skeletal system development IEA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
142988 5135 ENSG00000170178
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P35452
Protein name Homeobox protein Hox-D12 (Homeobox protein Hox-4H)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 203 259 Homeodomain Domain
Sequence
MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCAP
AQPAGATAFGGFSQPYLAGSGPLGLQPPTAKDGPEEQAKFYAPEAAAGPEERGRTRPSFA
PESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFKDDTKGPLNLNMTVQAAG
VASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLN
LSDQQVKIWFQNRRMKKKR
VVLREQALALY
Sequence length 270
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CONGENITAL CLUBFOOT Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HOXD12-related disorder Uncertain significance; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIMB DEFORMITIES, CONGENITAL CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MELANOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Celiac Disease Celiac disease Pubtator 27836013 Associate
★☆☆☆☆
Found in Text Mining only
Congenital clubfoot Congenital Clubfoot LHGDN 16331564
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Glioma Glioma Pubtator 18404365 Associate
★☆☆☆☆
Found in Text Mining only
Limb Deformities, Congenital Congenital anomaly of limb CTD_human_DG 19108020, 8620844
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
melanoma Melanoma CTD_human_DG 16778180
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Nystagmus Pathologic Nystagmus Pubtator 21654727 Associate
★☆☆☆☆
Found in Text Mining only
Oligodendroglioma Oligodendroglioma Pubtator 39259414 Associate
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 36213580 Stimulate
★☆☆☆☆
Found in Text Mining only
Syndactyly Syndactyly BEFREE 21654727
★☆☆☆☆
Found in Text Mining only
Syndactyly Syndactyly Pubtator 21654727 Associate
★☆☆☆☆
Found in Text Mining only