HOXD11 (homeobox D11)

Gene

• Entrez ID: 3237
• Gene name: Homeobox D11
• Gene symbol: HOXD11
• Synonyms (NCBI Gene): HOX4, HOX4F
• Chromosome: 2
• Chromosome location: 2q31.1
• Summary: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051956	hsa-let-7b-5p	CLASH	23622248
MIRT037516	hsa-miR-744-5p	CLASH	23622248
MIRT616275	hsa-miR-4706	HITS-CLIP	23824327
MIRT616276	hsa-miR-4749-5p	HITS-CLIP	23824327
MIRT037516	hsa-miR-744-5p	HITS-CLIP	23824327
MIRT616274	hsa-miR-4723-5p	HITS-CLIP	23824327
MIRT616273	hsa-miR-5698	HITS-CLIP	23824327
MIRT616271	hsa-miR-6870-5p	HITS-CLIP	23824327
MIRT616272	hsa-miR-7111-5p	HITS-CLIP	23824327
MIRT616270	hsa-miR-6795-5p	HITS-CLIP	23824327
MIRT616269	hsa-miR-6887-5p	HITS-CLIP	23824327
MIRT616268	hsa-miR-450a-5p	HITS-CLIP	23824327
MIRT616267	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616277	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT616275	hsa-miR-4706	HITS-CLIP	23824327
MIRT616276	hsa-miR-4749-5p	HITS-CLIP	23824327
MIRT037516	hsa-miR-744-5p	HITS-CLIP	23824327
MIRT616274	hsa-miR-4723-5p	HITS-CLIP	23824327
MIRT616273	hsa-miR-5698	HITS-CLIP	23824327
MIRT616271	hsa-miR-6870-5p	HITS-CLIP	23824327
MIRT616272	hsa-miR-7111-5p	HITS-CLIP	23824327
MIRT616270	hsa-miR-6795-5p	HITS-CLIP	23824327
MIRT616269	hsa-miR-6887-5p	HITS-CLIP	23824327
MIRT616268	hsa-miR-450a-5p	HITS-CLIP	23824327
MIRT616267	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT557037	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT557036	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT557035	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT557034	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT557033	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT557032	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT557031	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT557030	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT557029	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT557028	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT557027	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT557026	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT557025	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT557024	hsa-miR-3666	PAR-CLIP	21572407
MIRT557023	hsa-miR-4295	PAR-CLIP	21572407
MIRT557022	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT557021	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT557020	hsa-miR-4326	PAR-CLIP	21572407
MIRT557019	hsa-miR-5701	PAR-CLIP	21572407
MIRT557018	hsa-miR-513a-5p	PAR-CLIP	21572407
MIRT557017	hsa-miR-27a-3p	PAR-CLIP	21572407
MIRT557016	hsa-miR-27b-3p	PAR-CLIP	21572407
MIRT557015	hsa-miR-3674	PAR-CLIP	21572407
MIRT439125	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439125	hsa-miR-10b-5p	3'LIFE	25074381
MIRT616275	hsa-miR-4706	HITS-CLIP	23824327
MIRT616276	hsa-miR-4749-5p	HITS-CLIP	23824327
MIRT037516	hsa-miR-744-5p	HITS-CLIP	23824327
MIRT616274	hsa-miR-4723-5p	HITS-CLIP	23824327
MIRT616273	hsa-miR-5698	HITS-CLIP	23824327
MIRT616271	hsa-miR-6870-5p	HITS-CLIP	23824327
MIRT616272	hsa-miR-7111-5p	HITS-CLIP	23824327
MIRT616270	hsa-miR-6795-5p	HITS-CLIP	23824327
MIRT616269	hsa-miR-6887-5p	HITS-CLIP	23824327
MIRT616268	hsa-miR-450a-5p	HITS-CLIP	23824327
MIRT616267	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616277	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT616275	hsa-miR-4706	HITS-CLIP	23824327
MIRT616276	hsa-miR-4749-5p	HITS-CLIP	23824327
MIRT037516	hsa-miR-744-5p	HITS-CLIP	23824327
MIRT616274	hsa-miR-4723-5p	HITS-CLIP	23824327
MIRT616273	hsa-miR-5698	HITS-CLIP	23824327
MIRT616271	hsa-miR-6870-5p	HITS-CLIP	23824327
MIRT616272	hsa-miR-7111-5p	HITS-CLIP	23824327
MIRT616270	hsa-miR-6795-5p	HITS-CLIP	23824327
MIRT616269	hsa-miR-6887-5p	HITS-CLIP	23824327
MIRT616268	hsa-miR-450a-5p	HITS-CLIP	23824327
MIRT616267	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT557037	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT557036	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT557035	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT557034	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT557033	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT557032	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT557031	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT557030	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT557029	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT557028	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT557027	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT557026	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT557025	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT557024	hsa-miR-3666	PAR-CLIP	21572407
MIRT557023	hsa-miR-4295	PAR-CLIP	21572407
MIRT557022	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT557021	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT557020	hsa-miR-4326	PAR-CLIP	21572407
MIRT557019	hsa-miR-5701	PAR-CLIP	21572407
MIRT557018	hsa-miR-513a-5p	PAR-CLIP	21572407
MIRT557017	hsa-miR-27a-3p	PAR-CLIP	21572407
MIRT557016	hsa-miR-27b-3p	PAR-CLIP	21572407
MIRT557015	hsa-miR-3674	PAR-CLIP	21572407
MIRT1053742	hsa-miR-3136-3p	CLIP-seq
MIRT1053743	hsa-miR-3685	CLIP-seq
MIRT2012202	hsa-miR-1262	CLIP-seq
MIRT2012203	hsa-miR-4701-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009953	Process	Dorsal/ventral pattern formation	ISS
GO:0060272	Process	Embryonic skeletal joint morphogenesis	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 142986
• HGNC: 5134
• e!Ensembl: ENSG00000128713

Protein

• UniProt ID: P31277
• Protein name: Homeobox protein Hox-D11 (Homeobox protein Hox-4F)
• Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12045	DUF3528	26 → 80	Protein of unknown function (DUF3528)	Family
  PF12045	DUF3528	105 → 194	Protein of unknown function (DUF3528)	Family
  PF00046	Homeodomain	267 → 323	Homeodomain	Domain

• Sequence:

  MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVRE
  VAFRDYGLERAKWPYRGGGGGGSAGGGSSGGGPGGGGGGAGGYAPYYAAAAAAAAAAAAA
  EEAAMQRELLPPAGRRPDVLFKAPEPVCAAPGPPHGPAGAASNFYSAVGRNGILPQGFDQ
  FYEAAPGPPFAGPQPPPPPAPPQPEGAADKGDPRTGAGGGGGSPCTKATPGSEPKGAAEG
  SGGDGEGPPGEAGAEKSSSAVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLS
  RMLNLTDRQVKIWFQNRRMKEKKLNRDRLQYFTGNPLF

• Sequence length: 338

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES, DEVELOPMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMB DEFORMITIES, CONGENITAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	12542486		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19540081		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	19540081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	19540081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases, Developmental	Bone Disease	CTD_human_DG	7925020		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	15818620		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	19255789		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36151071	Associate	★☆☆☆☆ Found in Text Mining only
Congenital absence of kidney	Renal agenesis	BEFREE	19255789		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	BEFREE	19255789		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	27363011		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	25301728		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25301728	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	7596412		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11782354		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11782354		★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	CTD_human_DG	7596412, 7925020, 8620844		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	30867848	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27658780	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	25301728		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	15818620		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	22227861		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17303177		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	17303177		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17786296		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	15818620		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	15818620		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	15818620		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	22227861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	22227861, 27658780		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31698611	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	17303177		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27701467	Associate	★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	19255789		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	17568789		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22227861, 25301728, 27658780	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	22227861		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia-Absent Radius Syndrome	Thrombocytopenia-Absent Radius Syndrome	BEFREE	11841440		★☆☆☆☆ Found in Text Mining only