HOXC6 (homeobox C6)

Gene

• Entrez ID: 3223
• Gene name: Homeobox C6
• Gene symbol: HOXC6
• Synonyms (NCBI Gene): CP25, HHO.C8, HOX3, HOX3C
• Chromosome: 12
• Chromosome location: 12q13.13
• Summary: This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HO

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017144	hsa-miR-335-5p	Microarray	18185580
MIRT021916	hsa-miR-128-3p	Sequencing	20371350
MIRT028721	hsa-miR-27a-3p	Sequencing	20371350
MIRT502247	hsa-miR-6758-5p	PAR-CLIP	24398324
MIRT502246	hsa-miR-6856-5p	PAR-CLIP	24398324
MIRT502245	hsa-miR-6760-5p	PAR-CLIP	24398324
MIRT502244	hsa-miR-5681a	PAR-CLIP	24398324
MIRT502243	hsa-miR-4419a	PAR-CLIP	24398324
MIRT502242	hsa-miR-4510	PAR-CLIP	24398324
MIRT502241	hsa-miR-6127	PAR-CLIP	24398324
MIRT502240	hsa-miR-6129	PAR-CLIP	24398324
MIRT502239	hsa-miR-6130	PAR-CLIP	24398324
MIRT502237	hsa-miR-6133	PAR-CLIP	24398324
MIRT502238	hsa-miR-185-5p	PAR-CLIP	24398324
MIRT502236	hsa-miR-4306	PAR-CLIP	24398324
MIRT502235	hsa-miR-4644	PAR-CLIP	24398324
MIRT502234	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT502233	hsa-miR-6731-5p	PAR-CLIP	24398324
MIRT502232	hsa-miR-8085	PAR-CLIP	24398324
MIRT502231	hsa-miR-6090	PAR-CLIP	24398324
MIRT502230	hsa-miR-3175	PAR-CLIP	24398324
MIRT502229	hsa-miR-1343-5p	PAR-CLIP	24398324
MIRT502228	hsa-miR-939-5p	PAR-CLIP	24398324
MIRT502226	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT502227	hsa-miR-541-3p	PAR-CLIP	24398324
MIRT502225	hsa-miR-654-5p	PAR-CLIP	24398324
MIRT502224	hsa-miR-92a-2-5p	PAR-CLIP	24398324
MIRT502223	hsa-miR-6769a-5p	PAR-CLIP	24398324
MIRT502222	hsa-miR-6769b-5p	PAR-CLIP	24398324
MIRT502221	hsa-miR-491-5p	PAR-CLIP	24398324
MIRT502220	hsa-miR-3150a-3p	PAR-CLIP	24398324
MIRT502219	hsa-miR-6763-5p	PAR-CLIP	24398324
MIRT502247	hsa-miR-6758-5p	PAR-CLIP	24398324
MIRT502246	hsa-miR-6856-5p	PAR-CLIP	24398324
MIRT502245	hsa-miR-6760-5p	PAR-CLIP	24398324
MIRT502244	hsa-miR-5681a	PAR-CLIP	24398324
MIRT502243	hsa-miR-4419a	PAR-CLIP	24398324
MIRT502242	hsa-miR-4510	PAR-CLIP	24398324
MIRT502241	hsa-miR-6127	PAR-CLIP	24398324
MIRT502240	hsa-miR-6129	PAR-CLIP	24398324
MIRT502239	hsa-miR-6130	PAR-CLIP	24398324
MIRT502237	hsa-miR-6133	PAR-CLIP	24398324
MIRT502238	hsa-miR-185-5p	PAR-CLIP	24398324
MIRT502236	hsa-miR-4306	PAR-CLIP	24398324
MIRT502235	hsa-miR-4644	PAR-CLIP	24398324
MIRT502234	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT502233	hsa-miR-6731-5p	PAR-CLIP	24398324
MIRT502232	hsa-miR-8085	PAR-CLIP	24398324
MIRT502231	hsa-miR-6090	PAR-CLIP	24398324
MIRT502230	hsa-miR-3175	PAR-CLIP	24398324
MIRT502229	hsa-miR-1343-5p	PAR-CLIP	24398324
MIRT502228	hsa-miR-939-5p	PAR-CLIP	24398324
MIRT502226	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT502227	hsa-miR-541-3p	PAR-CLIP	24398324
MIRT502225	hsa-miR-654-5p	PAR-CLIP	24398324
MIRT502224	hsa-miR-92a-2-5p	PAR-CLIP	24398324
MIRT502223	hsa-miR-6769a-5p	PAR-CLIP	24398324
MIRT502222	hsa-miR-6769b-5p	PAR-CLIP	24398324
MIRT502221	hsa-miR-491-5p	PAR-CLIP	24398324
MIRT502220	hsa-miR-3150a-3p	PAR-CLIP	24398324
MIRT502219	hsa-miR-6763-5p	PAR-CLIP	24398324
MIRT1053622	hsa-miR-128	CLIP-seq
MIRT1053623	hsa-miR-1912	CLIP-seq
MIRT1053624	hsa-miR-193a-3p	CLIP-seq
MIRT1053625	hsa-miR-193b	CLIP-seq
MIRT1053626	hsa-miR-27a	CLIP-seq
MIRT1053627	hsa-miR-27b	CLIP-seq
MIRT1053628	hsa-miR-3074-3p	CLIP-seq
MIRT1053629	hsa-miR-3662	CLIP-seq
MIRT1053630	hsa-miR-377	CLIP-seq
MIRT1053631	hsa-miR-412	CLIP-seq
MIRT1053632	hsa-miR-4257	CLIP-seq
MIRT1053633	hsa-miR-4279	CLIP-seq
MIRT1053634	hsa-miR-4328	CLIP-seq
MIRT1053635	hsa-miR-4477a	CLIP-seq
MIRT1053636	hsa-miR-4794	CLIP-seq
MIRT1053637	hsa-miR-495	CLIP-seq
MIRT1053638	hsa-miR-553	CLIP-seq
MIRT1053639	hsa-miR-598	CLIP-seq
MIRT1053640	hsa-miR-711	CLIP-seq
MIRT1053641	hsa-miR-889	CLIP-seq
MIRT1053642	hsa-miR-892b	CLIP-seq
MIRT1053643	hsa-miR-1254	CLIP-seq
MIRT1053644	hsa-miR-1261	CLIP-seq
MIRT1053645	hsa-miR-1285	CLIP-seq
MIRT1053646	hsa-miR-141	CLIP-seq
MIRT1053647	hsa-miR-1587	CLIP-seq
MIRT1053648	hsa-miR-200a	CLIP-seq
MIRT1053649	hsa-miR-3116	CLIP-seq
MIRT1053650	hsa-miR-3152-5p	CLIP-seq
MIRT1053651	hsa-miR-3187-5p	CLIP-seq
MIRT1053652	hsa-miR-361-3p	CLIP-seq
MIRT1053653	hsa-miR-378g	CLIP-seq
MIRT1053654	hsa-miR-3914	CLIP-seq
MIRT1053655	hsa-miR-3945	CLIP-seq
MIRT1053656	hsa-miR-4253	CLIP-seq
MIRT1053657	hsa-miR-4320	CLIP-seq
MIRT1053658	hsa-miR-4492	CLIP-seq
MIRT1053659	hsa-miR-4498	CLIP-seq
MIRT1053660	hsa-miR-4505	CLIP-seq
MIRT1053661	hsa-miR-4656	CLIP-seq
MIRT1053662	hsa-miR-4666-3p	CLIP-seq
MIRT1053663	hsa-miR-4675	CLIP-seq
MIRT1053664	hsa-miR-4741	CLIP-seq
MIRT1053665	hsa-miR-4774-3p	CLIP-seq
MIRT1053666	hsa-miR-612	CLIP-seq
MIRT1053667	hsa-miR-661	CLIP-seq
MIRT1053668	hsa-miR-762	CLIP-seq
MIRT2012188	hsa-miR-185	CLIP-seq
MIRT2012189	hsa-miR-2467-3p	CLIP-seq
MIRT2012190	hsa-miR-4278	CLIP-seq
MIRT2012191	hsa-miR-4731-5p	CLIP-seq
MIRT2012192	hsa-miR-486-3p	CLIP-seq
MIRT2012193	hsa-miR-571	CLIP-seq
MIRT2244579	hsa-miR-548c-3p	CLIP-seq
MIRT2547407	hsa-miR-1207-5p	CLIP-seq
MIRT1053643	hsa-miR-1254	CLIP-seq
MIRT1053645	hsa-miR-1285	CLIP-seq
MIRT2547408	hsa-miR-1288	CLIP-seq
MIRT2547409	hsa-miR-1291	CLIP-seq
MIRT1053647	hsa-miR-1587	CLIP-seq
MIRT2012189	hsa-miR-2467-3p	CLIP-seq
MIRT2547410	hsa-miR-2682	CLIP-seq
MIRT1053649	hsa-miR-3116	CLIP-seq
MIRT2547411	hsa-miR-3151	CLIP-seq
MIRT1053650	hsa-miR-3152-5p	CLIP-seq
MIRT2547412	hsa-miR-3184	CLIP-seq
MIRT1053651	hsa-miR-3187-5p	CLIP-seq
MIRT2547413	hsa-miR-3199	CLIP-seq
MIRT1053652	hsa-miR-361-3p	CLIP-seq
MIRT2547414	hsa-miR-3650	CLIP-seq
MIRT1053653	hsa-miR-378g	CLIP-seq
MIRT1053655	hsa-miR-3945	CLIP-seq
MIRT2547415	hsa-miR-423-5p	CLIP-seq
MIRT1053656	hsa-miR-4253	CLIP-seq
MIRT2547416	hsa-miR-4292	CLIP-seq
MIRT1053657	hsa-miR-4320	CLIP-seq
MIRT2547417	hsa-miR-4447	CLIP-seq
MIRT2547418	hsa-miR-4472	CLIP-seq
MIRT2547419	hsa-miR-4489	CLIP-seq
MIRT1053658	hsa-miR-4492	CLIP-seq
MIRT1053659	hsa-miR-4498	CLIP-seq
MIRT2547420	hsa-miR-449c	CLIP-seq
MIRT1053660	hsa-miR-4505	CLIP-seq
MIRT1053661	hsa-miR-4656	CLIP-seq
MIRT1053662	hsa-miR-4666-3p	CLIP-seq
MIRT1053663	hsa-miR-4675	CLIP-seq
MIRT2547421	hsa-miR-4706	CLIP-seq
MIRT2012191	hsa-miR-4731-5p	CLIP-seq
MIRT2547422	hsa-miR-4734	CLIP-seq
MIRT1053664	hsa-miR-4741	CLIP-seq
MIRT2547423	hsa-miR-4749-5p	CLIP-seq
MIRT2547424	hsa-miR-4763-3p	CLIP-seq
MIRT1053665	hsa-miR-4774-3p	CLIP-seq
MIRT2012192	hsa-miR-486-3p	CLIP-seq
MIRT1053666	hsa-miR-612	CLIP-seq
MIRT2547425	hsa-miR-637	CLIP-seq
MIRT1053667	hsa-miR-661	CLIP-seq
MIRT2547426	hsa-miR-744	CLIP-seq
MIRT1053668	hsa-miR-762	CLIP-seq
MIRT2547427	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MLL2	Unknown	21683083
MLL3	Unknown	21683083

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8870653
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0048706	Process	Embryonic skeletal system development	IEA

Other IDs

• MIM: 142972
• HGNC: 5128
• e!Ensembl: ENSG00000197757

Protein

• UniProt ID: P09630
• Protein name: Homeobox protein Hox-C6 (Homeobox protein CP25) (Homeobox protein HHO.C8) (Homeobox protein Hox-3C)
• Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	142 → 198	Homeodomain	Domain

• Sequence:

  MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQEN
  VVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASI
  QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCL
  TERQIKIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE

• Sequence length: 235

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis	Arthritis	BEFREE	29930509, 30446734, 30557832, 30798135, 31521892, 31661133		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29410624, 30804784		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	9354682		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24937670		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25725483, 8870653		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21683083, 8870653	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28397780	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	18655788	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29348394	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31629025		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26046583		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	27574949		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30509141		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30509141, 30559605		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	39399504	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27935967, 31796117, 32957968, 34950145, 37434131, 38378070, 39399504	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33795652	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26046583		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	26310814		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30228024, 31564976		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30228024, 31564976		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28055976, 30228024		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28055976	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24786473	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	1971215		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35711425	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30804784		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	9327740		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	8634419, 9354682	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	9354682, 9823947		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	9823947		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29348394		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29348394	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	9327740	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	9354682		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	9354682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25725483		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	31629025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26046583		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15637592, 18339881, 25725483, 26310814, 27108162, 30129068, 30859272, 31026217		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23581417, 27573865		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23581417, 27840908, 29348394		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30509141		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	9823947		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	9823947		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28338202	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28775784, 29991129		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29991129	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18339881, 18655788, 22134668, 25725483, 27840908, 28775784, 29085488, 30559605		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	17488478		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17488478, 7501971	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	7501971		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	28775784		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30993034		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	26679893		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26046583		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26046583		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15637592, 24937670, 26310814, 27108162, 30129068, 30859272, 31026217		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	24937670	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20019190, 24513574, 28397780, 31271305, 31783839, 32012197	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27833659		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27833659	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30643209, 30771056, 31521892		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	40255403	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17294802		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29085488		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22896703, 32171324	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22896703		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27573865		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32745141	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30618083		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32515533	Associate	★☆☆☆☆ Found in Text Mining only