HOXB9 (homeobox B9)

Gene

• Entrez ID: 3219
• Gene name: Homeobox B9
• Gene symbol: HOXB9
• Synonyms (NCBI Gene): HOX-2.5, HOX2, HOX2E
• Chromosome: 17
• Chromosome location: 17q21.32
• Summary: This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcripti

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024768	hsa-miR-215-5p	Microarray	19074876
MIRT026516	hsa-miR-192-5p	Microarray	19074876
MIRT1053410	hsa-miR-122	CLIP-seq
MIRT1053411	hsa-miR-1249	CLIP-seq
MIRT1053412	hsa-miR-1262	CLIP-seq
MIRT1053413	hsa-miR-1273g	CLIP-seq
MIRT1053414	hsa-miR-1324	CLIP-seq
MIRT1053415	hsa-miR-139-5p	CLIP-seq
MIRT1053416	hsa-miR-147	CLIP-seq
MIRT1053417	hsa-miR-1909	CLIP-seq
MIRT1053418	hsa-miR-192	CLIP-seq
MIRT1053419	hsa-miR-2116	CLIP-seq
MIRT1053420	hsa-miR-215	CLIP-seq
MIRT1053421	hsa-miR-3119	CLIP-seq
MIRT1053422	hsa-miR-3136-5p	CLIP-seq
MIRT1053423	hsa-miR-3160-3p	CLIP-seq
MIRT1053424	hsa-miR-3164	CLIP-seq
MIRT1053425	hsa-miR-3170	CLIP-seq
MIRT1053426	hsa-miR-3184	CLIP-seq
MIRT1053427	hsa-miR-3198	CLIP-seq
MIRT1053428	hsa-miR-320e	CLIP-seq
MIRT1053429	hsa-miR-323-5p	CLIP-seq
MIRT1053430	hsa-miR-323b-5p	CLIP-seq
MIRT1053431	hsa-miR-346	CLIP-seq
MIRT1053432	hsa-miR-3618	CLIP-seq
MIRT1053433	hsa-miR-3657	CLIP-seq
MIRT1053434	hsa-miR-3670	CLIP-seq
MIRT1053435	hsa-miR-3691-5p	CLIP-seq
MIRT1053436	hsa-miR-3911	CLIP-seq
MIRT1053437	hsa-miR-3928	CLIP-seq
MIRT1053438	hsa-miR-423-5p	CLIP-seq
MIRT1053439	hsa-miR-4273	CLIP-seq
MIRT1053440	hsa-miR-4288	CLIP-seq
MIRT1053441	hsa-miR-4290	CLIP-seq
MIRT1053442	hsa-miR-4292	CLIP-seq
MIRT1053443	hsa-miR-4308	CLIP-seq
MIRT1053444	hsa-miR-4309	CLIP-seq
MIRT1053445	hsa-miR-4318	CLIP-seq
MIRT1053446	hsa-miR-4421	CLIP-seq
MIRT1053447	hsa-miR-4433	CLIP-seq
MIRT1053448	hsa-miR-4434	CLIP-seq
MIRT1053449	hsa-miR-4439	CLIP-seq
MIRT1053450	hsa-miR-4459	CLIP-seq
MIRT1053451	hsa-miR-4487	CLIP-seq
MIRT1053452	hsa-miR-4489	CLIP-seq
MIRT1053453	hsa-miR-4513	CLIP-seq
MIRT1053454	hsa-miR-4516	CLIP-seq
MIRT1053455	hsa-miR-451b	CLIP-seq
MIRT1053456	hsa-miR-4659a-3p	CLIP-seq
MIRT1053457	hsa-miR-4659b-3p	CLIP-seq
MIRT1053458	hsa-miR-4663	CLIP-seq
MIRT1053459	hsa-miR-4677-5p	CLIP-seq
MIRT1053460	hsa-miR-4693-5p	CLIP-seq
MIRT1053461	hsa-miR-4701-3p	CLIP-seq
MIRT1053462	hsa-miR-4716-3p	CLIP-seq
MIRT1053463	hsa-miR-4722-5p	CLIP-seq
MIRT1053464	hsa-miR-4723-5p	CLIP-seq
MIRT1053465	hsa-miR-4742-5p	CLIP-seq
MIRT1053466	hsa-miR-4747-3p	CLIP-seq
MIRT1053467	hsa-miR-4749-3p	CLIP-seq
MIRT1053468	hsa-miR-4752	CLIP-seq
MIRT1053469	hsa-miR-4764-5p	CLIP-seq
MIRT1053470	hsa-miR-4768-3p	CLIP-seq
MIRT1053471	hsa-miR-4772-5p	CLIP-seq
MIRT1053472	hsa-miR-4790-3p	CLIP-seq
MIRT1053473	hsa-miR-495	CLIP-seq
MIRT1053474	hsa-miR-558	CLIP-seq
MIRT1053475	hsa-miR-563	CLIP-seq
MIRT1053476	hsa-miR-571	CLIP-seq
MIRT1053477	hsa-miR-632	CLIP-seq
MIRT1053478	hsa-miR-644	CLIP-seq
MIRT1053479	hsa-miR-645	CLIP-seq
MIRT1053480	hsa-miR-654-3p	CLIP-seq
MIRT1053481	hsa-miR-876-3p	CLIP-seq
MIRT1053482	hsa-miR-885-5p	CLIP-seq
MIRT1053483	hsa-miR-892a	CLIP-seq
MIRT1053484	hsa-miR-892b	CLIP-seq
MIRT1053485	hsa-miR-934	CLIP-seq
MIRT1053486	hsa-miR-939	CLIP-seq
MIRT1053487	hsa-miR-943	CLIP-seq
MIRT2012158	hsa-miR-4799-5p	CLIP-seq
MIRT2012159	hsa-miR-577	CLIP-seq
MIRT2244467	hsa-miR-1253	CLIP-seq
MIRT2244468	hsa-miR-1323	CLIP-seq
MIRT2244469	hsa-miR-28-5p	CLIP-seq
MIRT2244470	hsa-miR-3065-5p	CLIP-seq
MIRT2244471	hsa-miR-3139	CLIP-seq
MIRT2244472	hsa-miR-3945	CLIP-seq
MIRT2244473	hsa-miR-4761-3p	CLIP-seq
MIRT2012158	hsa-miR-4799-5p	CLIP-seq
MIRT2244474	hsa-miR-548o	CLIP-seq
MIRT2244475	hsa-miR-708	CLIP-seq
MIRT2244467	hsa-miR-1253	CLIP-seq
MIRT2389130	hsa-miR-3173-3p	CLIP-seq
MIRT2389131	hsa-miR-4779	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0005515	Function	Protein binding	IPI	10617598, 16189514, 19060904, 21516116, 25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009954	Process	Proximal/distal pattern formation	IBA
GO:0030879	Process	Mammary gland development	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IBA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0060326	Process	Cell chemotaxis	IDA	19576624
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 142964
• HGNC: 5120
• e!Ensembl: ENSG00000170689

Protein

• UniProt ID: P17482
• Protein name: Homeobox protein Hox-B9 (Homeobox protein Hox-2.5) (Homeobox protein Hox-2E)
• Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04617	Hox9_act	1 → 172		Family
  PF00046	Homeodomain	186 → 242	Homeodomain	Domain

• Sequence:

  MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFG
  ASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEP
  LLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWL
  HARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKM
  KKMNKEQGKE

• Sequence length: 250

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute erythroleukemia	Erythroleukemia	CTD_human_DG	30926971		★☆☆☆☆ Found in Text Mining only
Acute erythroleukemia - M6a subtype	Erythroleukemia	CTD_human_DG	30926971		★☆☆☆☆ Found in Text Mining only
Acute erythroleukemia - M6b subtype	Erythroleukemia	CTD_human_DG	30926971		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	1351762		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia FAB-M6	Myeloid Leukemia	CTD_human_DG	30926971		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	25025961		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25324169, 26544896, 27613418, 31372881		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	17148583		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25724625, 31372881		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31504243		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31504243		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20080567, 22863320, 23053648, 25136922, 27182052		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20080567, 22863320	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21930940, 23260012, 25136922	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAMPOMELIC DYSPLASIA	Campomelic Dysplasia	BEFREE	8348155		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22863320, 26536658	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	37236926	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27613418		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35634239	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27556922	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29654889, 30867739, 31372881		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24885802, 28298545, 29199273		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35216396	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	19341834		★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	19341834, 24600698		★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	24600698	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29724991		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29724991, 36803556	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1360433		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	1360433		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24582746		★☆☆☆☆ Found in Text Mining only
Hip Dislocation, Congenital	Congenital Hip dislocation	BEFREE	19341834		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	17148583		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17148583		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	17148583, 33539429	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36033826	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28808656, 31128861		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1351762		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30926971	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	7678830		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24462859, 25056121, 28260092, 31310747		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20080567	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29724991	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30867739		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	32439996	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20080567, 22863320, 23053648, 25136922, 27182052		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29724991		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27613418		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28298545		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30867739		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25025961, 27041221, 27182052, 28260092, 28298545, 28514754, 29408459, 29724991		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29654889, 30867739, 31372881		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23053648		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29408459		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37031492	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11070089		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11485933, 20080567, 22863320, 23053648, 23260012, 24462859, 24885802, 25025961, 25136922, 26041877, 26991799, 27613418, 28298545, 29654889, 30867739		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1360433		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	2491782, 2491784, 2896630		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26544896		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33666541	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31970886	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28298545		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25724625, 31372881		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35634239	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	1351762		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	1351762		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1351762		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	27182052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32098919	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	1379214		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	1379214		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28298545		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25860510, 28808656	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37657018	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25860510		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30867739		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26536658	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	CTD_human_DG	27182052		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	CTD_human_DG	27182052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations