Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	3217
Gene name	Homeobox B7
Gene symbol	HOXB7
Synonyms (NCBI Gene)	HHO.C1HOX2HOX2CHox-2.3
Chromosome	17
Chromosome location	17q21.32
Summary	This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcriptio

151

Show/Hide all (151)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004244	hsa-miR-196a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	20480203
MIRT004244	hsa-miR-196a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	20480203
MIRT030282	hsa-miR-26b-5p	Microarray	19088304
MIRT438111	hsa-miR-196b-5p	Luciferase reporter assay	23861821
MIRT438111	hsa-miR-196b-5p	Luciferase reporter assay	23861821
MIRT1053382	hsa-miR-129-5p	CLIP-seq
MIRT1053383	hsa-miR-1470	CLIP-seq
MIRT1053384	hsa-miR-296-3p	CLIP-seq
MIRT1053385	hsa-miR-3121-3p	CLIP-seq
MIRT1053386	hsa-miR-3180-5p	CLIP-seq
MIRT1053387	hsa-miR-3927	CLIP-seq
MIRT1053388	hsa-miR-3935	CLIP-seq
MIRT1053389	hsa-miR-4279	CLIP-seq
MIRT1053390	hsa-miR-4287	CLIP-seq
MIRT1053391	hsa-miR-4469	CLIP-seq
MIRT1053392	hsa-miR-4667-3p	CLIP-seq
MIRT1053393	hsa-miR-4685-3p	CLIP-seq
MIRT1053394	hsa-miR-4713-5p	CLIP-seq
MIRT1053395	hsa-miR-4773	CLIP-seq
MIRT1053396	hsa-miR-520a-5p	CLIP-seq
MIRT1053397	hsa-miR-525-5p	CLIP-seq
MIRT1053398	hsa-miR-548v	CLIP-seq
MIRT1053399	hsa-miR-577	CLIP-seq
MIRT1053400	hsa-miR-889	CLIP-seq
MIRT2012151	hsa-miR-1236	CLIP-seq
MIRT2012152	hsa-miR-204	CLIP-seq
MIRT2012153	hsa-miR-211	CLIP-seq
MIRT2012154	hsa-miR-593	CLIP-seq
MIRT1053400	hsa-miR-889	CLIP-seq
MIRT2012151	hsa-miR-1236	CLIP-seq
MIRT2244399	hsa-miR-1276	CLIP-seq
MIRT2244400	hsa-miR-1323	CLIP-seq
MIRT2244401	hsa-miR-140-3p	CLIP-seq
MIRT2244402	hsa-miR-15a	CLIP-seq
MIRT2244403	hsa-miR-15b	CLIP-seq
MIRT2244404	hsa-miR-16	CLIP-seq
MIRT2244405	hsa-miR-1913	CLIP-seq
MIRT2244406	hsa-miR-195	CLIP-seq
MIRT2244407	hsa-miR-196a	CLIP-seq
MIRT2244408	hsa-miR-196b	CLIP-seq
MIRT2244409	hsa-miR-198	CLIP-seq
MIRT2244410	hsa-miR-2110	CLIP-seq
MIRT2244411	hsa-miR-2276	CLIP-seq
MIRT2244412	hsa-miR-24	CLIP-seq
MIRT2244413	hsa-miR-2467-5p	CLIP-seq
MIRT2244414	hsa-miR-3124-3p	CLIP-seq
MIRT2244415	hsa-miR-3150a-3p	CLIP-seq
MIRT2244416	hsa-miR-3158-3p	CLIP-seq
MIRT1053386	hsa-miR-3180-5p	CLIP-seq
MIRT2244417	hsa-miR-324-3p	CLIP-seq
MIRT2244418	hsa-miR-337-3p	CLIP-seq
MIRT2244419	hsa-miR-338-5p	CLIP-seq
MIRT2244420	hsa-miR-3616-3p	CLIP-seq
MIRT2244421	hsa-miR-3660	CLIP-seq
MIRT2244422	hsa-miR-3664-3p	CLIP-seq
MIRT2244423	hsa-miR-3685	CLIP-seq
MIRT2244424	hsa-miR-376c	CLIP-seq
MIRT2244425	hsa-miR-384	CLIP-seq
MIRT1053387	hsa-miR-3927	CLIP-seq
MIRT2244426	hsa-miR-424	CLIP-seq
MIRT2244427	hsa-miR-4271	CLIP-seq
MIRT2244428	hsa-miR-4276	CLIP-seq
MIRT2244429	hsa-miR-4283	CLIP-seq
MIRT2244430	hsa-miR-4302	CLIP-seq
MIRT2244431	hsa-miR-4310	CLIP-seq
MIRT2244432	hsa-miR-4311	CLIP-seq
MIRT2244433	hsa-miR-4433	CLIP-seq
MIRT2244434	hsa-miR-4436b-3p	CLIP-seq
MIRT2244435	hsa-miR-4459	CLIP-seq
MIRT2244436	hsa-miR-4526	CLIP-seq
MIRT2244437	hsa-miR-4536	CLIP-seq
MIRT2244438	hsa-miR-4540	CLIP-seq
MIRT2244439	hsa-miR-455-3p	CLIP-seq
MIRT2244440	hsa-miR-4696	CLIP-seq
MIRT2244441	hsa-miR-4721	CLIP-seq
MIRT2244442	hsa-miR-4725-3p	CLIP-seq
MIRT2244443	hsa-miR-4742-5p	CLIP-seq
MIRT2244444	hsa-miR-4755-3p	CLIP-seq
MIRT2244445	hsa-miR-4768-3p	CLIP-seq
MIRT1053395	hsa-miR-4773	CLIP-seq
MIRT2244446	hsa-miR-4779	CLIP-seq
MIRT2244447	hsa-miR-497	CLIP-seq
MIRT2244448	hsa-miR-499a-5p	CLIP-seq
MIRT2244449	hsa-miR-515-5p	CLIP-seq
MIRT1053396	hsa-miR-520a-5p	CLIP-seq
MIRT2244450	hsa-miR-520d-5p	CLIP-seq
MIRT2244451	hsa-miR-524-5p	CLIP-seq
MIRT1053397	hsa-miR-525-5p	CLIP-seq
MIRT2244452	hsa-miR-548a-3p	CLIP-seq
MIRT2244453	hsa-miR-548e	CLIP-seq
MIRT2244454	hsa-miR-548f	CLIP-seq
MIRT2244455	hsa-miR-548o	CLIP-seq
MIRT1053398	hsa-miR-548v	CLIP-seq
MIRT2244456	hsa-miR-583	CLIP-seq
MIRT2244457	hsa-miR-658	CLIP-seq
MIRT2244458	hsa-miR-938	CLIP-seq
MIRT2442258	hsa-miR-4760-5p	CLIP-seq
MIRT2442259	hsa-miR-501-5p	CLIP-seq
MIRT2442260	hsa-miR-587	CLIP-seq
MIRT1053383	hsa-miR-1470	CLIP-seq
MIRT2244407	hsa-miR-196a	CLIP-seq
MIRT2244408	hsa-miR-196b	CLIP-seq
MIRT1053385	hsa-miR-3121-3p	CLIP-seq
MIRT2244414	hsa-miR-3124-3p	CLIP-seq
MIRT2244418	hsa-miR-337-3p	CLIP-seq
MIRT2244423	hsa-miR-3685	CLIP-seq
MIRT2244425	hsa-miR-384	CLIP-seq
MIRT1053387	hsa-miR-3927	CLIP-seq
MIRT2244428	hsa-miR-4276	CLIP-seq
MIRT1053389	hsa-miR-4279	CLIP-seq
MIRT2547385	hsa-miR-4282	CLIP-seq
MIRT1053390	hsa-miR-4287	CLIP-seq
MIRT2244430	hsa-miR-4302	CLIP-seq
MIRT2547386	hsa-miR-4307	CLIP-seq
MIRT1053391	hsa-miR-4469	CLIP-seq
MIRT1053392	hsa-miR-4667-3p	CLIP-seq
MIRT1053393	hsa-miR-4685-3p	CLIP-seq
MIRT1053394	hsa-miR-4713-5p	CLIP-seq
MIRT2547387	hsa-miR-4729	CLIP-seq
MIRT2244448	hsa-miR-499a-5p	CLIP-seq
MIRT2547388	hsa-miR-513a-3p	CLIP-seq
MIRT2547389	hsa-miR-548aa	CLIP-seq
MIRT2547390	hsa-miR-548ac	CLIP-seq
MIRT2547391	hsa-miR-548d-3p	CLIP-seq
MIRT2547392	hsa-miR-548z	CLIP-seq
MIRT2547393	hsa-miR-579	CLIP-seq
MIRT2547394	hsa-miR-653	CLIP-seq
MIRT1053383	hsa-miR-1470	CLIP-seq
MIRT2244407	hsa-miR-196a	CLIP-seq
MIRT2244408	hsa-miR-196b	CLIP-seq
MIRT2244414	hsa-miR-3124-3p	CLIP-seq
MIRT2244418	hsa-miR-337-3p	CLIP-seq
MIRT2244423	hsa-miR-3685	CLIP-seq
MIRT2244425	hsa-miR-384	CLIP-seq
MIRT1053387	hsa-miR-3927	CLIP-seq
MIRT2244428	hsa-miR-4276	CLIP-seq
MIRT1053389	hsa-miR-4279	CLIP-seq
MIRT2547385	hsa-miR-4282	CLIP-seq
MIRT1053390	hsa-miR-4287	CLIP-seq
MIRT2244430	hsa-miR-4302	CLIP-seq
MIRT1053391	hsa-miR-4469	CLIP-seq
MIRT1053392	hsa-miR-4667-3p	CLIP-seq
MIRT1053393	hsa-miR-4685-3p	CLIP-seq
MIRT1053394	hsa-miR-4713-5p	CLIP-seq
MIRT2244448	hsa-miR-499a-5p	CLIP-seq
MIRT2547388	hsa-miR-513a-3p	CLIP-seq
MIRT2547389	hsa-miR-548aa	CLIP-seq
MIRT2547390	hsa-miR-548ac	CLIP-seq
MIRT2547391	hsa-miR-548d-3p	CLIP-seq
MIRT2547392	hsa-miR-548z	CLIP-seq
MIRT2547394	hsa-miR-653	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
NFYA	Unknown	12697323
NFYB	Unknown	12697323
NFYC	Unknown	12697323
SP1	Unknown	12697323
SP3	Unknown	12697323
USF1	Unknown	12697323
YY1	Unknown	12697323

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	8756643
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	8756643
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	1678287
GO:0005515	Function	Protein binding	IPI	17308091, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	1678287
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	1678287
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8756643
GO:0048568	Process	Embryonic organ development	IEP	2885844
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142962	5118	ENSG00000260027

P09629

Protein name

Homeobox protein Hox-B7 (Homeobox protein HHO.C1) (Homeobox protein Hox-2C)

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	138 → 194	Homeodomain	Domain

Sequence

MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYP
GGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
ESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQ
IKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE

Sequence length

217

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (90)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	1351762, 30537478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24088503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22911672, 29576613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22914903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	26991799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30537478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10842316		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22914903, 24641834, 25183455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	24641834	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22603795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	22603795	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	30670912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile Duct Neoplasms	LHGDN	16673309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12414653, 17018609, 18378073, 21690342, 25542862, 26014856, 26135503, 26180042, 9681827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10435624, 26014856, 26135503, 34680970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CAMPOMELIC DYSPLASIA	Campomelic Dysplasia	BEFREE	8348155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	28749115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26307396, 33977077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28454092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29576613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22914903	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24088503, 24641834, 25183455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	30951946		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23861821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23861821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30537478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22879911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22879911	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24586698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17540169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21474578, 27855613, 28533224, 31648103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24641368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1360433, 17514648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17514648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	1360433, 17514648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30964174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30964174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	27618447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30664713		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1351762, 9681827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38254070	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	7678830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	27834359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27272787, 28454092, 28646927, 31609764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22914903, 24088503, 30964174	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27901487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12414653, 17018609, 18378073, 21690342, 25542862, 26014856, 26135503, 26180042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29576613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27834359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22879911, 22914903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30317675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26968988, 27901487, 31190875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26076456, 26135503, 27834359, 28646927, 28677742, 28749115, 30067384, 30379579, 31190875, 31568655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	23627614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23861821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25542862		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15077196, 18378073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20480203, 23400877, 8756643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	25565354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21953534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21953534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	38254070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11522651, 16862184, 22911672, 22914903, 24641834, 25542862, 26991799, 28646927, 28749115, 29277771, 30067384, 30379579, 30664713, 30964174, 31190875, 31568655, 31609764 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	25565354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1360433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	2491782, 2491784, 2896630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24853421, 26913601, 29277771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	36285482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27983923, 28677742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11274429	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22879911, 22914903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22914903, 25183455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22879911	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22914903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34101221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	1351762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	1351762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1351762, 30537478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30317675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	1379214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	1379214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27855613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23627614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26076456, 30844117, 31568655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24076275, 24519855, 33315534, 35945754, 36285482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30067384, 30379579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26968988, 27901487, 31190875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26307396	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34680970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23861821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HOXB7 (homeobox B7)