HOXA9 (homeobox A9)

Gene

• Entrez ID: 3205
• Gene name: Homeobox A9
• Gene symbol: HOXA9
• Synonyms (NCBI Gene): ABD-B, HOX1, HOX1.7, HOX1G
• Chromosome: 7
• Chromosome location: 7p15.2
• Summary: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001918	hsa-miR-126-3p	GFP reporter assay, qRT-PCR, Western blot	18474618
MIRT001917	hsa-miR-145-5p	GFP reporter assay, qRT-PCR, Western blot	18474618
MIRT001917	hsa-miR-145-5p	GFP reporter assay, qRT-PCR, Western blot	18474618
MIRT001918	hsa-miR-126-3p	Luciferase reporter assay	18474618
MIRT000149	hsa-miR-210-3p	Luciferase reporter assay	19782034
MIRT016142	hsa-miR-652-3p	Sequencing	20371350
MIRT019591	hsa-miR-340-5p	Sequencing	20371350
MIRT027337	hsa-miR-101-3p	Sequencing	20371350
MIRT027927	hsa-miR-96-5p	Sequencing	20371350
MIRT028225	hsa-miR-33a-5p	Sequencing	20371350
MIRT030092	hsa-miR-26b-5p	Sequencing	20371350
MIRT030986	hsa-miR-21-5p	Microarray	18591254
MIRT031333	hsa-miR-18a-5p	Sequencing	20371350
MIRT043225	hsa-miR-324-5p	CLASH	23622248
MIRT039078	hsa-miR-769-3p	CLASH	23622248
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22353710
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22353710
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22353710
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22353710
MIRT438331	hsa-miR-142-3p	Luciferase reporter assay	24057258
MIRT053330	hsa-miR-196b-5p	ChIP-seq	24334453
MIRT030986	hsa-miR-21-5p	ChIP-seq	24334453
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay	23894305
MIRT438331	hsa-miR-142-3p	Luciferase reporter assay	24057258
MIRT053330	hsa-miR-196b-5p	ChIP-seq	24334453
MIRT030986	hsa-miR-21-5p	ChIP-seq	24334453
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay	23894305
MIRT258269	hsa-miR-3154	HITS-CLIP	23824327
MIRT657313	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT657312	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT657311	hsa-miR-4267	HITS-CLIP	23824327
MIRT657310	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT657309	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT657308	hsa-miR-4421	HITS-CLIP	23824327
MIRT657307	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT657306	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT657305	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT657304	hsa-miR-7977	HITS-CLIP	23824327
MIRT657303	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT657302	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT053330	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547902	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT571995	hsa-miR-548ac	PAR-CLIP	20371350
MIRT571994	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT571993	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT571992	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT571991	hsa-miR-548z	PAR-CLIP	20371350
MIRT571990	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT571989	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT571988	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT571987	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT571986	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT571985	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT571984	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT547901	hsa-miR-548m	PAR-CLIP	20371350
MIRT527502	hsa-miR-6856-3p	PAR-CLIP	20371350
MIRT527501	hsa-miR-181c-3p	PAR-CLIP	20371350
MIRT103533	hsa-miR-3163	PAR-CLIP	20371350
MIRT527500	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT547900	hsa-miR-4528	PAR-CLIP	20371350
MIRT320406	hsa-miR-1284	PAR-CLIP	20371350
MIRT547899	hsa-miR-3124-3p	PAR-CLIP	20371350
MIRT019591	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT527499	hsa-miR-421	PAR-CLIP	20371350
MIRT053330	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547902	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT547901	hsa-miR-548m	PAR-CLIP	20371350
MIRT527500	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT547900	hsa-miR-4528	PAR-CLIP	20371350
MIRT547899	hsa-miR-3124-3p	PAR-CLIP	20371350
MIRT019591	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT527499	hsa-miR-421	PAR-CLIP	20371350
MIRT557099	hsa-miR-182-5p	PAR-CLIP	21572407
MIRT557098	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT103531	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT557097	hsa-miR-136-3p	PAR-CLIP	21572407
MIRT557096	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT557095	hsa-miR-16-2-3p	PAR-CLIP	21572407
MIRT557094	hsa-miR-195-3p	PAR-CLIP	21572407
MIRT320463	hsa-miR-4470	PAR-CLIP	21572407
MIRT557093	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT557092	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT027927	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT053330	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547902	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547901	hsa-miR-548m	PAR-CLIP	21572407
MIRT103533	hsa-miR-3163	PAR-CLIP	21572407
MIRT527500	hsa-miR-4709-5p	PAR-CLIP	21572407
MIRT547900	hsa-miR-4528	PAR-CLIP	21572407
MIRT547899	hsa-miR-3124-3p	PAR-CLIP	21572407
MIRT019591	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT527499	hsa-miR-421	PAR-CLIP	21572407
MIRT541201	hsa-miR-548av-3p	PAR-CLIP	21572407
MIRT527502	hsa-miR-6856-3p	PAR-CLIP	22012620
MIRT527501	hsa-miR-181c-3p	PAR-CLIP	22012620
MIRT527500	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT320406	hsa-miR-1284	PAR-CLIP	22012620
MIRT320400	hsa-let-7f-2-3p	PAR-CLIP	22012620
MIRT320405	hsa-miR-1185-1-3p	PAR-CLIP	22012620
MIRT320404	hsa-miR-1185-2-3p	PAR-CLIP	22012620
MIRT527499	hsa-miR-421	PAR-CLIP	22012620
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR	26586336
MIRT053330	hsa-miR-196b-5p	Microarray, qRT-PCR	33611311
MIRT053330	hsa-miR-196b-5p	Microarray, qRT-PCR	33611311
MIRT557099	hsa-miR-182-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31906958
MIRT000149	hsa-miR-210-3p	Western blotting, Luciferase reporter assay, qRT-PCR	31875764
MIRT733218	hsa-miR-19b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31564891
MIRT734806	hsa-miR-652-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31740654
MIRT735757	hsa-miR-186-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31802902
MIRT258269	hsa-miR-3154	HITS-CLIP	23824327
MIRT657313	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT657312	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT657311	hsa-miR-4267	HITS-CLIP	23824327
MIRT657310	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT657309	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT657308	hsa-miR-4421	HITS-CLIP	23824327
MIRT657307	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT657306	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT657305	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT657304	hsa-miR-7977	HITS-CLIP	23824327
MIRT657303	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT657302	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT053330	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547902	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT571995	hsa-miR-548ac	PAR-CLIP	20371350
MIRT571994	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT571993	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT571992	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT571991	hsa-miR-548z	PAR-CLIP	20371350
MIRT571990	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT571989	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT571988	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT571987	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT571986	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT571985	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT571984	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT547901	hsa-miR-548m	PAR-CLIP	20371350
MIRT527502	hsa-miR-6856-3p	PAR-CLIP	20371350
MIRT527501	hsa-miR-181c-3p	PAR-CLIP	20371350
MIRT103533	hsa-miR-3163	PAR-CLIP	20371350
MIRT527500	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT547900	hsa-miR-4528	PAR-CLIP	20371350
MIRT320406	hsa-miR-1284	PAR-CLIP	20371350
MIRT547899	hsa-miR-3124-3p	PAR-CLIP	20371350
MIRT019591	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT527499	hsa-miR-421	PAR-CLIP	20371350
MIRT053330	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547902	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT547901	hsa-miR-548m	PAR-CLIP	20371350
MIRT527500	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT547900	hsa-miR-4528	PAR-CLIP	20371350
MIRT547899	hsa-miR-3124-3p	PAR-CLIP	20371350
MIRT019591	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT527499	hsa-miR-421	PAR-CLIP	20371350
MIRT557099	hsa-miR-182-5p	PAR-CLIP	21572407
MIRT557098	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT103531	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT557097	hsa-miR-136-3p	PAR-CLIP	21572407
MIRT557096	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT557095	hsa-miR-16-2-3p	PAR-CLIP	21572407
MIRT557094	hsa-miR-195-3p	PAR-CLIP	21572407
MIRT320463	hsa-miR-4470	PAR-CLIP	21572407
MIRT557093	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT557092	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT027927	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT053330	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547902	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547901	hsa-miR-548m	PAR-CLIP	21572407
MIRT103533	hsa-miR-3163	PAR-CLIP	21572407
MIRT527500	hsa-miR-4709-5p	PAR-CLIP	21572407
MIRT547900	hsa-miR-4528	PAR-CLIP	21572407
MIRT547899	hsa-miR-3124-3p	PAR-CLIP	21572407
MIRT019591	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT527499	hsa-miR-421	PAR-CLIP	21572407
MIRT541201	hsa-miR-548av-3p	PAR-CLIP	21572407
MIRT527502	hsa-miR-6856-3p	PAR-CLIP	22012620
MIRT527501	hsa-miR-181c-3p	PAR-CLIP	22012620
MIRT527500	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT320406	hsa-miR-1284	PAR-CLIP	22012620
MIRT320400	hsa-let-7f-2-3p	PAR-CLIP	22012620
MIRT320405	hsa-miR-1185-1-3p	PAR-CLIP	22012620
MIRT320404	hsa-miR-1185-2-3p	PAR-CLIP	22012620
MIRT527499	hsa-miR-421	PAR-CLIP	22012620
MIRT756085	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	35800618
MIRT756085	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	35800618
MIRT1053270	hsa-miR-1193	CLIP-seq
MIRT1053271	hsa-miR-133a	CLIP-seq
MIRT1053272	hsa-miR-133b	CLIP-seq
MIRT1053273	hsa-miR-147b	CLIP-seq
MIRT1053274	hsa-miR-210	CLIP-seq
MIRT1053275	hsa-miR-2113	CLIP-seq
MIRT1053276	hsa-miR-3153	CLIP-seq
MIRT1053277	hsa-miR-3165	CLIP-seq
MIRT1053278	hsa-miR-4282	CLIP-seq
MIRT1053279	hsa-miR-4420	CLIP-seq
MIRT1053280	hsa-miR-4646-5p	CLIP-seq
MIRT1053281	hsa-miR-4668-5p	CLIP-seq
MIRT1053282	hsa-miR-4706	CLIP-seq
MIRT1053283	hsa-miR-4749-5p	CLIP-seq
MIRT1053284	hsa-miR-542-5p	CLIP-seq
MIRT1053285	hsa-miR-744	CLIP-seq
MIRT1549598	hsa-let-7a	CLIP-seq
MIRT1549599	hsa-let-7b	CLIP-seq
MIRT1549600	hsa-let-7c	CLIP-seq
MIRT1549601	hsa-let-7d	CLIP-seq
MIRT1549602	hsa-let-7e	CLIP-seq
MIRT1549603	hsa-let-7f	CLIP-seq
MIRT1549604	hsa-let-7g	CLIP-seq
MIRT1549605	hsa-let-7i	CLIP-seq
MIRT1549606	hsa-miR-1245b-5p	CLIP-seq
MIRT1053271	hsa-miR-133a	CLIP-seq
MIRT1053272	hsa-miR-133b	CLIP-seq
MIRT1549607	hsa-miR-199a-3p	CLIP-seq
MIRT1549608	hsa-miR-199b-3p	CLIP-seq
MIRT1549609	hsa-miR-202	CLIP-seq
MIRT1549610	hsa-miR-25	CLIP-seq
MIRT1549611	hsa-miR-3129-5p	CLIP-seq
MIRT1549612	hsa-miR-3142	CLIP-seq
MIRT1549613	hsa-miR-32	CLIP-seq
MIRT1549614	hsa-miR-363	CLIP-seq
MIRT1549615	hsa-miR-367	CLIP-seq
MIRT1549616	hsa-miR-4458	CLIP-seq
MIRT1549617	hsa-miR-4500	CLIP-seq
MIRT1549618	hsa-miR-4672	CLIP-seq
MIRT1549619	hsa-miR-518a-5p	CLIP-seq
MIRT1549620	hsa-miR-527	CLIP-seq
MIRT1549621	hsa-miR-548ae	CLIP-seq
MIRT1549622	hsa-miR-548aj	CLIP-seq
MIRT1549623	hsa-miR-548am	CLIP-seq
MIRT1549624	hsa-miR-548x	CLIP-seq
MIRT1549625	hsa-miR-606	CLIP-seq
MIRT1549626	hsa-miR-92a	CLIP-seq
MIRT1549627	hsa-miR-92b	CLIP-seq
MIRT1549628	hsa-miR-936	CLIP-seq
MIRT1549629	hsa-miR-98	CLIP-seq
MIRT1556545	hsa-miR-140-3p	CLIP-seq
MIRT2429701	hsa-miR-3065-3p	CLIP-seq
MIRT2429702	hsa-miR-365	CLIP-seq
MIRT2429703	hsa-miR-4313	CLIP-seq
MIRT2547323	hsa-miR-1251	CLIP-seq
MIRT2547324	hsa-miR-21	CLIP-seq
MIRT2429701	hsa-miR-3065-3p	CLIP-seq
MIRT2429702	hsa-miR-365	CLIP-seq
MIRT2547325	hsa-miR-3688-3p	CLIP-seq
MIRT2547326	hsa-miR-3978	CLIP-seq
MIRT2547327	hsa-miR-4277	CLIP-seq
MIRT2429703	hsa-miR-4313	CLIP-seq
MIRT2547328	hsa-miR-4694-3p	CLIP-seq
MIRT2547329	hsa-miR-4768-5p	CLIP-seq
MIRT2547330	hsa-miR-590-5p	CLIP-seq
MIRT2547323	hsa-miR-1251	CLIP-seq
MIRT2547324	hsa-miR-21	CLIP-seq
MIRT2429701	hsa-miR-3065-3p	CLIP-seq
MIRT2682451	hsa-miR-338-5p	CLIP-seq
MIRT2429702	hsa-miR-365	CLIP-seq
MIRT2547325	hsa-miR-3688-3p	CLIP-seq
MIRT2547326	hsa-miR-3978	CLIP-seq
MIRT2547327	hsa-miR-4277	CLIP-seq
MIRT2429703	hsa-miR-4313	CLIP-seq
MIRT2682452	hsa-miR-4691-5p	CLIP-seq
MIRT2547328	hsa-miR-4694-3p	CLIP-seq
MIRT2547329	hsa-miR-4768-5p	CLIP-seq
MIRT2547330	hsa-miR-590-5p	CLIP-seq
MIRT2682453	hsa-miR-875-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREBBP	Activation	16849538
KAT6A	Activation	22713874;23994619
NFKB1	Repression	18068911
SALL4	Activation	24051379
SUZ12	Unknown	15225548

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 22269951, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009954	Process	Proximal/distal pattern formation	IBA
GO:0009954	Process	Proximal/distal pattern formation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0019899	Function	Enzyme binding	IPI	22269951
GO:0030850	Process	Prostate gland development	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0035115	Process	Embryonic forelimb morphogenesis	IEA
GO:0042118	Process	Endothelial cell activation	IMP	22269951
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IEA
GO:0045638	Process	Negative regulation of myeloid cell differentiation	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IBA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0060065	Process	Uterus development	IEA
GO:0060216	Process	Definitive hemopoiesis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 142956
• HGNC: 5109
• e!Ensembl: ENSG00000078399

Protein

• UniProt ID: P31269
• Protein name: Homeobox protein Hox-A9 (Homeobox protein Hox-1G)
• Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Required for induction of SELE/E-selectin and VCAM1 on the endothel
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04617	Hox9_act	1 → 193		Family
  PF00046	Homeodomain	207 → 263	Homeodomain	Domain

• Sequence:

  MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKA
  TVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALS
  FAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNA
  ENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVA
  RLLNLTERQVKIWFQNRRMKMKKINKDRAKDE

• Sequence length: 272

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	12032333, 16518848, 18337761, 19056693, 19620287, 26059450, 27258906, 30270123		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11314021, 12358913, 16029452, 16102826, 18337761, 22025528		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19225539, 21810091, 22305570, 24532712, 25987065		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	22541086		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	22541086		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	19005624		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10602420		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	19667399, 28411381, 28436985		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19281776		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28525852, 30032824		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	31099823		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16102826, 22025528		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	10221343		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	25785959		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	36734258	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37620966	Associate	★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	36734258	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	26332997		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27598218		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	10848835	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10848835, 12032333, 20639863, 21810091		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	LHGDN	16630659		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20727230, 23716660, 28748001		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16766534, 27409175, 28748001, 34416888	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20727230	Inhibit	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31043660	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23569218	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16803519, 17623056, 31041828		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20079733, 20676325, 22976466, 28951629, 38062093	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27598218		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21480815, 21757291, 24817037, 26586336, 27880728, 30697674		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25966226, 28387653	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28662726	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17369352	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15821746, 22945634, 24332016, 25023983, 28387653		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16803519, 27039722		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	16803519, 27039722		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	16102826, 22025528		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24089088		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24089088	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	28515451	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	28662726		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23996689		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	11157742, 21810091, 22932805		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17203192, 17254481		★☆☆☆☆ Found in Text Mining only
Clubfoot	Clubfoot	Pubtator	19938081	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28464221		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28464221, 28969042, 29435001, 30552679, 31099823		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35743243, 36065412, 38285101	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	25625843	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10565304, 11314021		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	27020427, 31424148		★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	24886209	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26522113		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26522113, 31787246	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	25785959		★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa with pyloric atresia	Epidermolysis bullosa	Pubtator	30850842	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25023983, 28387653		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31802902		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19472401	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31802902		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19472401	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20068170, 21339190, 21947269, 25762636		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20068170, 20935218, 21947269, 33154193	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20068170, 21339190, 21947269, 25762636		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21339190, 21947269, 30536324, 35845958	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25762636, 30536324		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35349479	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24671639	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	26768750		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	14604967, 36192425	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	31213012		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	28662726		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis Epidermolytic	Epidermolytic hyperkeratosis	Pubtator	31701765	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	20805992	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	26134223	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31729468		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	10565304		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	24308157		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10602420, 11157742, 11161815, 11830496, 11841413, 1348930, 15721637, 15851025, 16061630, 16709517, 17916434, 18388181, 18668134, 19056693, 19155294, 19667399, 20541448, 21471525, 22353710, 22508837, 22633751, 22990017, 23079661, 23264595, 23990460, 23996689, 24021671, 24334453, 24445817, 24465000, 24612037, 25082879, 25911551, 26028034, 27018596, 27258906, 27617578, 27838340, 28210005, 28229434, 28399410, 28411381, 28961318, 29459712, 29496663, 29972300, 30214626, 30384975, 30622285, 31099823, 31413090, 8563753		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11369863, 14604967, 15657436, 16709517, 20565746, 23818607, 24858818, 27317766, 33001025, 33924850, 34502319, 36139405, 36595475, 38216972	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10996203, 11830496	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	17327400	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10848835, 10936866, 11830496, 15721637, 17327400, 19696924, 20565746, 20805992, 21937451, 23840580, 25987065, 31164492, 32664447, 34502319, 36577137, 36595475, 36861732, 37027440, 38216972	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	14604967, 31426381	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10221343, 10397741, 10583265, 10602420, 10848835, 10936866, 11157742, 11241795, 11314021, 11830496, 12032333, 12112533, 14561764, 14604967, 15479723, 15982348, 16029452, 16102826, 16105979, 16518848, 16912223, 17327400, 17442773, 18410541, 19005624, 19225539, 19667399, 19696924, 20193845, 20565746, 21467841, 21471525, 21810091, 21937451, 22305570, 22932805, 22964640, 23575938, 24051379, 24334453, 24532712, 24535405, 25795706, 25987065, 26028034, 26418229, 26517931, 26542893, 26642852, 26747896, 27063597, 27065320, 27340869, 27617578, 27641501, 28399410, 28521413, 28961318, 29217774, 29346763, 29384529, 29760161, 30214626, 30384975, 30463913, 30622285, 30645099, 30679800, 30799057, 31031188, 31120998, 31213012, 31378673, 31670914, 8563754, 9649441		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12112533, 17178874, 18410541, 18668134		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	22541086		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	10565304		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	29496663		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24886209		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24681432		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	21480815		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22522909, 30516882, 32138766, 37038139	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30843252	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38285101	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	20935218		★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	23349797		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	20068170		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20727230, 23716660, 24633304, 28748001		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26522113		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31802902		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21480815, 21757291, 24817037, 26586336, 27880728, 30697674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24886209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17623056, 22945634, 24332016, 25023983		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28484075		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29113222		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	26332997		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27598218		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11841413, 15709170, 24067365, 24633304, 28484075, 28855354, 28961318, 29496663, 29724719, 31213012		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16803519, 27039722		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28464221		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23716660		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	16778180		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	28578692	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	LHGDN	16105979		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23349797	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	24141373, 31413090		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11070089		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	24886209	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10583265, 10936866, 11241795, 15982348, 17178874, 17442773, 24216483		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	17178874		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15982348	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	10602420, 11830496, 15454493, 22902925		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10602420, 10848835, 11830496, 12032333, 12112533, 12649177, 16630659, 17442773, 20141430, 20639863, 21810091, 23894305		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	11157742, 17442773, 19338047, 21810091, 22932805, 23954893		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	19338047	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	30674274		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15316056, 15821746, 17369352, 17623056, 17671196, 21480815, 22305570, 22723371, 22945634, 24332016, 24633304, 24681432, 24817037, 24886209, 25625843, 26134223, 26332997, 27225590, 27598218, 28525852, 28961318, 29662084, 30032824, 30575897, 30639384, 30843252, 31683603, 7967520		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23619990		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21757291, 24817037, 26586336, 27240011, 27880728, 30697674		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34588385	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29254169, 30575897, 30816476		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22945634, 24332016, 25023983		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17623056, 25625843, 34419462, 34514844	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36366735	Stimulate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	28662726		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31043660		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	31041828		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	18337761		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26059450, 29496663		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28484075		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28484075		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35372588	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21769840	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	33224314	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17369352, 24886209		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21558411, 24671639, 24886209, 28780773, 29927694, 30843252, 34850551	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	21558411		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29662084, 31683603		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24671639, 30843252		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29113222		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21769840		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	33224314	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31043660	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	34719830	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23056278, 26332997, 27598218	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urogenital Abnormalities	Urogenital abnormalities	Pubtator	36734258	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27039722	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	31740654	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	21388517	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	15561107		★☆☆☆☆ Found in Text Mining only