HOXA7 (homeobox A7)

Gene

• Entrez ID: 3204
• Gene name: Homeobox A7
• Gene symbol: HOXA7
• Synonyms (NCBI Gene): ANTP, HOX1, HOX1.1, HOX1A
• Chromosome: 7
• Chromosome location: 7p15.2
• Summary: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002940	hsa-miR-196a-5p	Western blot	19418581
MIRT002940	hsa-miR-196a-5p	Review	20029422
MIRT004640	hsa-miR-196b-5p	Review	20029422
MIRT002940	hsa-miR-196a-5p	Luciferase reporter assay	15105502
MIRT002940	hsa-miR-196a-5p	Sequencing	20371350
MIRT049904	hsa-miR-31-5p	CLASH	23622248
MIRT002940	hsa-miR-196a-5p	CLASH	23622248
MIRT038144	hsa-miR-423-5p	CLASH	23622248
MIRT438330	hsa-miR-142-3p	Luciferase reporter assay	24057258
MIRT438330	hsa-miR-142-3p	Luciferase reporter assay	24057258
MIRT1053261	hsa-miR-101	CLIP-seq
MIRT1053262	hsa-miR-144	CLIP-seq
MIRT1053263	hsa-miR-3671	CLIP-seq
MIRT1053264	hsa-miR-4261	CLIP-seq
MIRT1053265	hsa-miR-4496	CLIP-seq
MIRT1053266	hsa-miR-4686	CLIP-seq
MIRT1053267	hsa-miR-548aa	CLIP-seq
MIRT1053268	hsa-miR-548c-3p	CLIP-seq
MIRT1053269	hsa-miR-607	CLIP-seq
MIRT2012124	hsa-miR-1266	CLIP-seq
MIRT2012125	hsa-miR-320a	CLIP-seq
MIRT2012126	hsa-miR-320b	CLIP-seq
MIRT2012127	hsa-miR-320c	CLIP-seq
MIRT2012128	hsa-miR-320d	CLIP-seq
MIRT2012129	hsa-miR-3689a-3p	CLIP-seq
MIRT2012130	hsa-miR-3689c	CLIP-seq
MIRT2012131	hsa-miR-4270	CLIP-seq
MIRT2012132	hsa-miR-4429	CLIP-seq
MIRT2012133	hsa-miR-4441	CLIP-seq
MIRT2012134	hsa-miR-4518	CLIP-seq
MIRT2244368	hsa-miR-199a-5p	CLIP-seq
MIRT2244369	hsa-miR-199b-5p	CLIP-seq
MIRT2244370	hsa-miR-3147	CLIP-seq
MIRT2244371	hsa-miR-376c	CLIP-seq
MIRT2244372	hsa-miR-4425	CLIP-seq
MIRT2244373	hsa-miR-450b-3p	CLIP-seq
MIRT2244374	hsa-miR-4646-5p	CLIP-seq
MIRT2244375	hsa-miR-769-3p	CLIP-seq
MIRT2451318	hsa-miR-1275	CLIP-seq
MIRT2451319	hsa-miR-3170	CLIP-seq
MIRT2451320	hsa-miR-3176	CLIP-seq
MIRT2451321	hsa-miR-3922-3p	CLIP-seq
MIRT2451322	hsa-miR-4665-5p	CLIP-seq
MIRT2451323	hsa-miR-661	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PCGF2	Activation	22085718
PCGF2	Repression	22085718

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11435435
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11435435, 14704364
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11435435
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11435435
GO:0001525	Process	Angiogenesis	IEP	17972163
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IDA	14704364
GO:0002686	Process	Negative regulation of leukocyte migration	IDA	14704364
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	11435435
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0043565	Function	Sequence-specific DNA binding	IDA	11435435
GO:0045617	Process	Negative regulation of keratinocyte differentiation	IDA	11435435
GO:0045656	Process	Negative regulation of monocyte differentiation	IDA	14704364
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11435435
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11435435
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	18973687
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 142950
• HGNC: 5108
• e!Ensembl: ENSG00000122592

Protein

• UniProt ID: P31268
• Protein name: Homeobox protein Hox-A7 (Homeobox protein Hox 1.1) (Homeobox protein Hox-1A)
• Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	131 → 187	Homeodomain	Domain

• Sequence:

  MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSP
  LYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIY
  PWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN
  RRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE

• Sequence length: 230

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	19281776		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	17959889		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29285211		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21373886, 24099775		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29539431	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11742062	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17959889		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	11742062	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32444962	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17369352	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17959889, 29455183		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	28515451	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17203192, 17254481		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29483812	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	11742062		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17959889		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	11742062		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37248653	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	39596630	Associate	★☆☆☆☆ Found in Text Mining only
Familial paroxysmal dystonia	Paroxysmal dystonia	Pubtator	24001773	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21947269, 27677590, 28055976	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28055976		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35349479	Stimulate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	16466395		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1348930, 8563753		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10996203	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10996203, 34051812	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31426381	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10996203, 15479723, 26828989		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32138766	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28529281	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21373886, 24099775		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27600149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17959889, 29455183		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28529281		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21373886		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	22735029		★☆☆☆☆ Found in Text Mining only
Meningiomas, Multiple	Meningioma	BEFREE	22735029		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11070089		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34102907	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17369352, 17959889, 21373886, 28529281, 29455183, 30720179		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30720179		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	30720179	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32650806	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11742062, 17959889, 29455183		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11742062	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30575306		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29285211		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17369352, 28529281		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28529281	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	15561107		★☆☆☆☆ Found in Text Mining only