Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	3202
Gene name	Homeobox A5
Gene symbol	HOXA5
Synonyms (NCBI Gene)	HOX1HOX1.3HOX1C
Chromosome	7
Chromosome location	7p15.2
Summary	In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo

197

Show/Hide all (197)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000958	hsa-miR-130a-3p	Luciferase reporter assayqRT-PCRWestern blotNorthern blot	17957028
MIRT000958	hsa-miR-130a-3p	Review	19935707
MIRT001794	hsa-miR-19a-3p	Luciferase reporter assay	14697198
MIRT006906	hsa-miR-196a-5p	Luciferase reporter assayqRT-PCRWestern blot	22876840
MIRT016043	hsa-miR-374b-5p	Sequencing	20371350
MIRT016627	hsa-miR-484	Sequencing	20371350
MIRT019581	hsa-miR-340-5p	Sequencing	20371350
MIRT020201	hsa-miR-130b-3p	Sequencing	20371350
MIRT000958	hsa-miR-130a-3p	Reporter assay;Other	17957028
MIRT025008	hsa-miR-183-5p	Sequencing	20371350
MIRT031182	hsa-miR-19b-3p	Sequencing	20371350
MIRT001794	hsa-miR-19a-3p	Reporter assay;Other	21271217
MIRT049277	hsa-miR-92a-3p	CLASH	23622248
MIRT320350	hsa-miR-200c-3p	qRT-PCR	23294929
MIRT320350	hsa-miR-200c-3p	qRT-PCR	23294929
MIRT025008	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT547915	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT547914	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT547913	hsa-miR-3666	PAR-CLIP	21572407
MIRT547912	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT547911	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT547910	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT020201	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT547909	hsa-miR-4295	PAR-CLIP	21572407
MIRT000958	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT547908	hsa-miR-8485	PAR-CLIP	21572407
MIRT258223	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT547907	hsa-miR-1909-5p	PAR-CLIP	21572407
MIRT547906	hsa-miR-1238-5p	PAR-CLIP	21572407
MIRT547905	hsa-miR-4758-5p	PAR-CLIP	21572407
MIRT547904	hsa-miR-4658	PAR-CLIP	21572407
MIRT547903	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT006906	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT513875	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT513873	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT513874	hsa-miR-3927-3p	PAR-CLIP	23446348
MIRT513872	hsa-miR-6831-5p	PAR-CLIP	23446348
MIRT513871	hsa-miR-6830-5p	PAR-CLIP	23446348
MIRT513870	hsa-miR-4457	PAR-CLIP	23446348
MIRT513868	hsa-miR-302b-5p	PAR-CLIP	23446348
MIRT513869	hsa-miR-302d-5p	PAR-CLIP	23446348
MIRT513867	hsa-miR-5585-3p	PAR-CLIP	23446348
MIRT734037	hsa-miR-891a-5p	Luciferase reporter assayWestern blottingqRT-PCR	33986868
MIRT025008	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT547915	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT547914	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT547913	hsa-miR-3666	PAR-CLIP	21572407
MIRT547912	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT547911	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT547910	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT020201	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT547909	hsa-miR-4295	PAR-CLIP	21572407
MIRT000958	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT547908	hsa-miR-8485	PAR-CLIP	21572407
MIRT258223	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT547907	hsa-miR-1909-5p	PAR-CLIP	21572407
MIRT547906	hsa-miR-1238-5p	PAR-CLIP	21572407
MIRT547905	hsa-miR-4758-5p	PAR-CLIP	21572407
MIRT547904	hsa-miR-4658	PAR-CLIP	21572407
MIRT547903	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT006906	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT513875	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT513873	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT513874	hsa-miR-3927-3p	PAR-CLIP	23446348
MIRT513872	hsa-miR-6831-5p	PAR-CLIP	23446348
MIRT513871	hsa-miR-6830-5p	PAR-CLIP	23446348
MIRT513870	hsa-miR-4457	PAR-CLIP	23446348
MIRT513868	hsa-miR-302b-5p	PAR-CLIP	23446348
MIRT513869	hsa-miR-302d-5p	PAR-CLIP	23446348
MIRT513867	hsa-miR-5585-3p	PAR-CLIP	23446348
MIRT1053201	hsa-miR-1271	CLIP-seq
MIRT1053202	hsa-miR-1278	CLIP-seq
MIRT1053203	hsa-miR-128	CLIP-seq
MIRT1053204	hsa-miR-129-5p	CLIP-seq
MIRT1053205	hsa-miR-1297	CLIP-seq
MIRT1053206	hsa-miR-1305	CLIP-seq
MIRT1053207	hsa-miR-130a	CLIP-seq
MIRT1053208	hsa-miR-130b	CLIP-seq
MIRT1053209	hsa-miR-196a	CLIP-seq
MIRT1053210	hsa-miR-196b	CLIP-seq
MIRT1053211	hsa-miR-200b	CLIP-seq
MIRT1053212	hsa-miR-200c	CLIP-seq
MIRT1053213	hsa-miR-26a	CLIP-seq
MIRT1053214	hsa-miR-26b	CLIP-seq
MIRT1053215	hsa-miR-27a	CLIP-seq
MIRT1053216	hsa-miR-27b	CLIP-seq
MIRT1053217	hsa-miR-301a	CLIP-seq
MIRT1053218	hsa-miR-301b	CLIP-seq
MIRT1053219	hsa-miR-3117-5p	CLIP-seq
MIRT1053220	hsa-miR-3179	CLIP-seq
MIRT1053221	hsa-miR-320a	CLIP-seq
MIRT1053222	hsa-miR-320b	CLIP-seq
MIRT1053223	hsa-miR-320c	CLIP-seq
MIRT1053224	hsa-miR-320d	CLIP-seq
MIRT1053225	hsa-miR-3682-5p	CLIP-seq
MIRT1053226	hsa-miR-382	CLIP-seq
MIRT1053227	hsa-miR-3927	CLIP-seq
MIRT1053228	hsa-miR-3941	CLIP-seq
MIRT1053229	hsa-miR-3977	CLIP-seq
MIRT1053230	hsa-miR-429	CLIP-seq
MIRT1053231	hsa-miR-4311	CLIP-seq
MIRT1053232	hsa-miR-4429	CLIP-seq
MIRT1053233	hsa-miR-4436a	CLIP-seq
MIRT1053234	hsa-miR-4438	CLIP-seq
MIRT1053235	hsa-miR-4465	CLIP-seq
MIRT1053236	hsa-miR-454	CLIP-seq
MIRT1053237	hsa-miR-4652-5p	CLIP-seq
MIRT1053238	hsa-miR-466	CLIP-seq
MIRT1053239	hsa-miR-4672	CLIP-seq
MIRT1053240	hsa-miR-4711-3p	CLIP-seq
MIRT1053241	hsa-miR-4713-3p	CLIP-seq
MIRT1053242	hsa-miR-4716-3p	CLIP-seq
MIRT1053243	hsa-miR-4720-3p	CLIP-seq
MIRT1053244	hsa-miR-4731-3p	CLIP-seq
MIRT1053245	hsa-miR-4789-5p	CLIP-seq
MIRT1053246	hsa-miR-4801	CLIP-seq
MIRT1053247	hsa-miR-4804-3p	CLIP-seq
MIRT1053248	hsa-miR-498	CLIP-seq
MIRT1053249	hsa-miR-5095	CLIP-seq
MIRT1053250	hsa-miR-548ac	CLIP-seq
MIRT1053251	hsa-miR-548ae	CLIP-seq
MIRT1053252	hsa-miR-548aj	CLIP-seq
MIRT1053253	hsa-miR-548am	CLIP-seq
MIRT1053254	hsa-miR-548d-3p	CLIP-seq
MIRT1053255	hsa-miR-548x	CLIP-seq
MIRT1053256	hsa-miR-548z	CLIP-seq
MIRT1053257	hsa-miR-592	CLIP-seq
MIRT1053258	hsa-miR-599	CLIP-seq
MIRT1053259	hsa-miR-802	CLIP-seq
MIRT1053260	hsa-miR-96	CLIP-seq
MIRT1053205	hsa-miR-1297	CLIP-seq
MIRT1053213	hsa-miR-26a	CLIP-seq
MIRT1053214	hsa-miR-26b	CLIP-seq
MIRT1053225	hsa-miR-3682-5p	CLIP-seq
MIRT1053229	hsa-miR-3977	CLIP-seq
MIRT1053235	hsa-miR-4465	CLIP-seq
MIRT1053259	hsa-miR-802	CLIP-seq
MIRT2012092	hsa-miR-124	CLIP-seq
MIRT1053202	hsa-miR-1278	CLIP-seq
MIRT1053203	hsa-miR-128	CLIP-seq
MIRT2012093	hsa-miR-1283	CLIP-seq
MIRT2012094	hsa-miR-1289	CLIP-seq
MIRT1053204	hsa-miR-129-5p	CLIP-seq
MIRT2012095	hsa-miR-142-5p	CLIP-seq
MIRT1053209	hsa-miR-196a	CLIP-seq
MIRT1053210	hsa-miR-196b	CLIP-seq
MIRT2012096	hsa-miR-19a	CLIP-seq
MIRT2012097	hsa-miR-19b	CLIP-seq
MIRT1053211	hsa-miR-200b	CLIP-seq
MIRT1053212	hsa-miR-200c	CLIP-seq
MIRT2012098	hsa-miR-224	CLIP-seq
MIRT1053215	hsa-miR-27a	CLIP-seq
MIRT1053216	hsa-miR-27b	CLIP-seq
MIRT1053219	hsa-miR-3117-5p	CLIP-seq
MIRT2012099	hsa-miR-3180-5p	CLIP-seq
MIRT2012100	hsa-miR-3198	CLIP-seq
MIRT2012101	hsa-miR-329	CLIP-seq
MIRT2012102	hsa-miR-337-3p	CLIP-seq
MIRT2012103	hsa-miR-340	CLIP-seq
MIRT2012104	hsa-miR-3622a-5p	CLIP-seq
MIRT2012105	hsa-miR-362-3p	CLIP-seq
MIRT1053227	hsa-miR-3927	CLIP-seq
MIRT1053230	hsa-miR-429	CLIP-seq
MIRT2012106	hsa-miR-4294	CLIP-seq
MIRT2012107	hsa-miR-4309	CLIP-seq
MIRT2012108	hsa-miR-432	CLIP-seq
MIRT2012109	hsa-miR-4328	CLIP-seq
MIRT2012110	hsa-miR-4484	CLIP-seq
MIRT1053241	hsa-miR-4713-3p	CLIP-seq
MIRT2012111	hsa-miR-4797-3p	CLIP-seq
MIRT2012112	hsa-miR-4797-5p	CLIP-seq
MIRT2012113	hsa-miR-506	CLIP-seq
MIRT2012114	hsa-miR-517a	CLIP-seq
MIRT2012115	hsa-miR-517b	CLIP-seq
MIRT2012116	hsa-miR-517c	CLIP-seq
MIRT2012117	hsa-miR-518a-5p	CLIP-seq
MIRT2012118	hsa-miR-520a-5p	CLIP-seq
MIRT2012119	hsa-miR-525-5p	CLIP-seq
MIRT2012120	hsa-miR-527	CLIP-seq
MIRT2012121	hsa-miR-548an	CLIP-seq
MIRT2012122	hsa-miR-574-3p	CLIP-seq
MIRT1053258	hsa-miR-599	CLIP-seq
MIRT2012123	hsa-miR-767-3p	CLIP-seq
MIRT2244364	hsa-miR-1252	CLIP-seq
MIRT1053215	hsa-miR-27a	CLIP-seq
MIRT1053216	hsa-miR-27b	CLIP-seq
MIRT2244365	hsa-miR-3942-3p	CLIP-seq
MIRT1053243	hsa-miR-4720-3p	CLIP-seq
MIRT1053244	hsa-miR-4731-3p	CLIP-seq
MIRT1053246	hsa-miR-4801	CLIP-seq
MIRT1053247	hsa-miR-4804-3p	CLIP-seq
MIRT2244366	hsa-miR-499a-5p	CLIP-seq
MIRT2244367	hsa-miR-890	CLIP-seq
MIRT1053204	hsa-miR-129-5p	CLIP-seq
MIRT2465447	hsa-miR-145	CLIP-seq
MIRT2465448	hsa-miR-375	CLIP-seq
MIRT2465449	hsa-miR-561	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10879542
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10879542
GO:0001501	Process	Skeletal system development	IEA
GO:0002009	Process	Morphogenesis of an epithelium	IEA
GO:0003016	Process	Respiratory system process	IEA
GO:0003677	Function	DNA binding	IDA	8657138
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	10879542, 16756717
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	15545268, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15545268
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007389	Process	Pattern specification process	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	10875927
GO:0016477	Process	Cell migration	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	17957028, 23136161
GO:0030324	Process	Lung development	IEA
GO:0030878	Process	Thyroid gland development	IEA
GO:0033599	Process	Regulation of mammary gland epithelial cell proliferation	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	10879542
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IDA	10397719
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IDA	10397719
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10879542, 16756717
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0060435	Process	Bronchiole development	IEA
GO:0060439	Process	Trachea morphogenesis	IEA
GO:0060441	Process	Epithelial tube branching involved in lung morphogenesis	IEA
GO:0060480	Process	Lung goblet cell differentiation	IEA
GO:0060481	Process	Lobar bronchus epithelium development	IEA
GO:0060484	Process	Lung-associated mesenchyme development	IEA
GO:0060535	Process	Trachea cartilage morphogenesis	IEA
GO:0060536	Process	Cartilage morphogenesis	IEA
GO:0060574	Process	Intestinal epithelial cell maturation	IEA
GO:0060638	Process	Mesenchymal-epithelial cell signaling	IEA
GO:0060644	Process	Mammary gland epithelial cell differentiation	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060764	Process	Cell-cell signaling involved in mammary gland development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142952	5106	ENSG00000106004

P20719

Protein name

Homeobox protein Hox-A5 (Homeobox protein Hox-1C)

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	196 → 252	Homeodomain	Domain

Sequence

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSG
SGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKN
SLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWM
RKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK
IWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

Sequence length

270

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (104)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26846409, 28810515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16525661, 28529621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25875824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34027794	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28810515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24196163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37038196, 40244264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	21311178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	31701765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36398888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	40349045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24650279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	17785556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10875927, 10879542, 14701762, 15545268, 16861263, 17167183, 17804711, 19554572, 27157614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10875927, 17167183	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12819009, 14701762, 15545268, 15757903, 16756717, 27809618, 37595068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15757903, 29532406, 31882852, 33136093, 33941222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	37834206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26249178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19554572, 25875824, 28529621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36536414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30201235		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30483748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30483748		★★★★★ ★☆☆☆☆ Found in Text Mining only
CHARGE Syndrome	Charge syndrome	Pubtator	28475860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28810515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24196163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	21876633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17203192, 17254481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30015922, 31159758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31159758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26678341, 28337372, 29532406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29532406, 33136093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	25585874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20846263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32041280, 35203377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29439250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	12163409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31880256, 37834206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	33667269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28055976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28055976, 37812190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35349479	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	15545268, 16756717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21454882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	32938406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	36398888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	35203377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	11238043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	11238043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	26846409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35836279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	32736574	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kabuki syndrome	Kabuki syndrome	Pubtator	28475860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1348930, 17785556, 26397212, 26846409		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17785556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17785556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	27052693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25987065, 27460741, 32614525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31426381	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16861263, 25585874, 31168296		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	26219418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	26219418	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	40185033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25549794	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33136093, 36454866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10879542, 11501577, 14701762, 15545268, 16861263, 17804711, 18538349, 19554572, 25875824, 27157614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19554572, 25875824, 28529621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	22227861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30201235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30015922, 30267809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20846263, 23864708, 25875824, 26678341, 28067383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30483748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30015922, 31159758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10879542, 17167183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14701762, 16756717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24196163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29174371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29221131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31441588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	22227861		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	31779094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17785556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16575877, 16861263, 19554572, 20130239, 22227861, 24674026, 25875824, 27960137, 28338293, 28423732, 30015922, 30201235, 30267809, 30940212, 31159758, 31168296 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19554572, 22876840, 25549794, 25686496, 25875824, 28338293, 28423732, 28529621, 29412790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	26249178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24058506, 35203377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29221131, 29439250, 31441588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30521886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32675397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30201235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33667269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31882852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28482119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	31701765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	28811488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	28811488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22227861, 28529621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17342311, 27960137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22227861	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	22227861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30015922, 30267809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24674026, 32736574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	15561107		★★★★★ ★☆☆☆☆ Found in Text Mining only

HOXA5 (homeobox A5)