Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3192
Gene name	Heterogeneous nuclear ribonucleoprotein U
Gene symbol	HNRNPU
Synonyms (NCBI Gene)	DEE54EIEE54GRIP120HNRNPU-AS1HNRPUSAF-ASAFAU21.1hnRNP Upp120
Chromosome	1
Chromosome location	1q44
Summary	This gene encodes a member of a family of proteins that bind nucleic acids and function in the formation of ribonucleoprotein complexes in the nucleus with heterogeneous nuclear RNA (hnRNA). The encoded protein has affinity for both RNA and DNA, and binds

Show/Hide all (35)

SNP ID	Visualize variation	Clinical significance	Consequence
rs779453109	GCCTTCCGCC>-	Pathogenic	Intron variant, frameshift variant, coding sequence variant
rs869312701	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs886041983	G>A	Pathogenic	Coding sequence variant, stop gained
rs1057520065	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1057524584	G>T	Pathogenic	Stop gained, coding sequence variant
rs1057524915	G>A	Pathogenic	Stop gained, coding sequence variant
rs1057524916	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1064794823	->TGGGGCCGCTGCTCTTCCCCGC	Pathogenic	Coding sequence variant, frameshift variant
rs1064796710	GAAAA>-	Uncertain-significance, pathogenic	Intron variant
rs1064797011	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1135401732	C>A,G,T	Pathogenic, uncertain-significance	Stop gained, missense variant, coding sequence variant
rs1135401733	G>A	Pathogenic	Stop gained, coding sequence variant
rs1135401794	C>AAT	Pathogenic	Coding sequence variant, frameshift variant
rs1553282372	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1553282385	G>A	Pathogenic	Coding sequence variant, stop gained
rs1553282390	G>A	Pathogenic	Coding sequence variant, stop gained
rs1553282635	G>A	Pathogenic	Coding sequence variant, stop gained
rs1553282723	C>T	Likely-pathogenic	Intron variant
rs1553282754	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1553283037	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1553283444	CGTGGTC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553283831	->G	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1553283895	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553283899	G>A	Pathogenic	Coding sequence variant, stop gained
rs1553283916	GT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1553283946	TAGCTCC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553283951	G>A	Pathogenic	Coding sequence variant, stop gained
rs1553283982	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1553284007	CGGAATCCCCGCCCAG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1558188078	C>G	Likely-pathogenic	Splice donor variant
rs1558190933	CTTTTTTACATTAACAG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1573330458	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1573330502	GCCACCT>-	Likely-pathogenic	Coding sequence variant, splice acceptor variant
rs1573337948	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1573338529	AAAG>-	Likely-pathogenic	Coding sequence variant, frameshift variant

834

Show/Hide all (834)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005282	hsa-miR-1-3p	pSILAC	18668040
MIRT005282	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT025868	hsa-miR-7-5p	Sequencing	20371350
MIRT050837	hsa-miR-17-5p	CLASH	23622248
MIRT050141	hsa-miR-26a-5p	CLASH	23622248
MIRT047974	hsa-miR-30c-5p	CLASH	23622248
MIRT046200	hsa-miR-27b-3p	CLASH	23622248
MIRT045483	hsa-miR-149-5p	CLASH	23622248
MIRT045483	hsa-miR-149-5p	CLASH	23622248
MIRT045483	hsa-miR-149-5p	CLASH	23622248
MIRT045256	hsa-miR-186-5p	CLASH	23622248
MIRT045256	hsa-miR-186-5p	CLASH	23622248
MIRT039706	hsa-miR-615-3p	CLASH	23622248
MIRT039706	hsa-miR-615-3p	CLASH	23622248
MIRT725415	hsa-miR-501-5p	HITS-CLIP	19536157
MIRT725414	hsa-miR-1245b-3p	HITS-CLIP	19536157
MIRT523150	hsa-miR-198	HITS-CLIP	19536157
MIRT725413	hsa-miR-5100	HITS-CLIP	19536157
MIRT725412	hsa-miR-3942-3p	HITS-CLIP	19536157
MIRT725411	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT725410	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT725409	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT557203	hsa-miR-548c-3p	HITS-CLIP	22927820
MIRT135086	hsa-miR-548av-3p	HITS-CLIP	22927820
MIRT135069	hsa-miR-548g-3p	HITS-CLIP	22927820
MIRT706094	hsa-miR-888-3p	HITS-CLIP	22927820
MIRT706093	hsa-miR-4728-3p	HITS-CLIP	22927820
MIRT557201	hsa-miR-3613-3p	HITS-CLIP	22927820
MIRT706092	hsa-miR-4536-3p	HITS-CLIP	22927820
MIRT706091	hsa-miR-6730-3p	HITS-CLIP	22927820
MIRT706090	hsa-miR-7162-3p	HITS-CLIP	22927820
MIRT706089	hsa-miR-642a-3p	HITS-CLIP	22927820
MIRT706088	hsa-miR-642b-3p	HITS-CLIP	22927820
MIRT706087	hsa-miR-655-5p	HITS-CLIP	22927820
MIRT706086	hsa-miR-377-5p	HITS-CLIP	22927820
MIRT706085	hsa-miR-6086	HITS-CLIP	22927820
MIRT706084	hsa-miR-4663	HITS-CLIP	22927820
MIRT706083	hsa-miR-7160-5p	HITS-CLIP	22927820
MIRT706082	hsa-miR-8077	HITS-CLIP	22927820
MIRT706081	hsa-miR-597-3p	HITS-CLIP	22927820
MIRT706080	hsa-miR-2117	HITS-CLIP	22927820
MIRT706079	hsa-miR-517a-3p	HITS-CLIP	22927820
MIRT706078	hsa-miR-517b-3p	HITS-CLIP	22927820
MIRT706077	hsa-miR-517c-3p	HITS-CLIP	22927820
MIRT706076	hsa-miR-4753-3p	HITS-CLIP	22927820
MIRT186644	hsa-let-7c-3p	HITS-CLIP	22927820
MIRT706075	hsa-miR-6809-3p	HITS-CLIP	22927820
MIRT557200	hsa-miR-548ae-3p	HITS-CLIP	22927820
MIRT557199	hsa-miR-548aj-3p	HITS-CLIP	22927820
MIRT557198	hsa-miR-548aq-3p	HITS-CLIP	22927820
MIRT557197	hsa-miR-548x-3p	HITS-CLIP	22927820
MIRT113132	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT511454	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT511452	hsa-miR-5094	PAR-CLIP	20371350
MIRT511453	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT511451	hsa-miR-4277	PAR-CLIP	20371350
MIRT511450	hsa-miR-6505-3p	PAR-CLIP	20371350
MIRT511449	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT511448	hsa-miR-3924	PAR-CLIP	20371350
MIRT511447	hsa-miR-4531	PAR-CLIP	20371350
MIRT511446	hsa-miR-1270	PAR-CLIP	20371350
MIRT511445	hsa-miR-620	PAR-CLIP	20371350
MIRT113135	hsa-miR-3611	PAR-CLIP	20371350
MIRT511444	hsa-miR-578	PAR-CLIP	20371350
MIRT511443	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT113132	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT511454	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT511452	hsa-miR-5094	PAR-CLIP	21572407
MIRT511453	hsa-miR-584-3p	PAR-CLIP	21572407
MIRT511451	hsa-miR-4277	PAR-CLIP	21572407
MIRT511450	hsa-miR-6505-3p	PAR-CLIP	21572407
MIRT511449	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT511448	hsa-miR-3924	PAR-CLIP	21572407
MIRT511447	hsa-miR-4531	PAR-CLIP	21572407
MIRT511446	hsa-miR-1270	PAR-CLIP	21572407
MIRT511445	hsa-miR-620	PAR-CLIP	21572407
MIRT113135	hsa-miR-3611	PAR-CLIP	21572407
MIRT511444	hsa-miR-578	PAR-CLIP	21572407
MIRT511443	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT557203	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT135086	hsa-miR-548av-3p	PAR-CLIP	21572407
MIRT135069	hsa-miR-548g-3p	PAR-CLIP	21572407
MIRT557202	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT557201	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT186644	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT557200	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT557199	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT557198	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT557197	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT113132	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT511454	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT511452	hsa-miR-5094	PAR-CLIP	21572407
MIRT511453	hsa-miR-584-3p	PAR-CLIP	21572407
MIRT511451	hsa-miR-4277	PAR-CLIP	21572407
MIRT511450	hsa-miR-6505-3p	PAR-CLIP	21572407
MIRT511449	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT547923	hsa-miR-4434	PAR-CLIP	21572407
MIRT547921	hsa-miR-4516	PAR-CLIP	21572407
MIRT547922	hsa-miR-5703	PAR-CLIP	21572407
MIRT511448	hsa-miR-3924	PAR-CLIP	21572407
MIRT511447	hsa-miR-4531	PAR-CLIP	21572407
MIRT511446	hsa-miR-1270	PAR-CLIP	21572407
MIRT511445	hsa-miR-620	PAR-CLIP	21572407
MIRT113135	hsa-miR-3611	PAR-CLIP	21572407
MIRT511444	hsa-miR-578	PAR-CLIP	21572407
MIRT511443	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT547920	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT547919	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547918	hsa-miR-34a-3p	PAR-CLIP	21572407
MIRT547917	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT547916	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523154	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT045256	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT523153	hsa-miR-3133	PAR-CLIP	23446348
MIRT523152	hsa-miR-320e	PAR-CLIP	23446348
MIRT523151	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT523150	hsa-miR-198	PAR-CLIP	23446348
MIRT523149	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT523148	hsa-miR-7159-3p	PAR-CLIP	23446348
MIRT113132	hsa-miR-493-3p	PAR-CLIP	23446348
MIRT511454	hsa-miR-329-5p	PAR-CLIP	23446348
MIRT511452	hsa-miR-5094	PAR-CLIP	23446348
MIRT511453	hsa-miR-584-3p	PAR-CLIP	23446348
MIRT511451	hsa-miR-4277	PAR-CLIP	23446348
MIRT511450	hsa-miR-6505-3p	PAR-CLIP	23446348
MIRT511449	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT511448	hsa-miR-3924	PAR-CLIP	23446348
MIRT511447	hsa-miR-4531	PAR-CLIP	23446348
MIRT511446	hsa-miR-1270	PAR-CLIP	23446348
MIRT511445	hsa-miR-620	PAR-CLIP	23446348
MIRT113135	hsa-miR-3611	PAR-CLIP	23446348
MIRT511444	hsa-miR-578	PAR-CLIP	23446348
MIRT511443	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT475554	hsa-miR-3662	PAR-CLIP	23592263
MIRT475553	hsa-miR-6732-3p	PAR-CLIP	23592263
MIRT475552	hsa-miR-5683	PAR-CLIP	23592263
MIRT475551	hsa-miR-577	PAR-CLIP	23592263
MIRT475550	hsa-miR-3163	PAR-CLIP	23592263
MIRT475549	hsa-miR-3668	PAR-CLIP	23592263
MIRT727487	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727486	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT547923	hsa-miR-4434	PAR-CLIP	26701625
MIRT547921	hsa-miR-4516	PAR-CLIP	26701625
MIRT547922	hsa-miR-5703	PAR-CLIP	26701625
MIRT725415	hsa-miR-501-5p	HITS-CLIP	19536157
MIRT725414	hsa-miR-1245b-3p	HITS-CLIP	19536157
MIRT523150	hsa-miR-198	HITS-CLIP	19536157
MIRT725413	hsa-miR-5100	HITS-CLIP	19536157
MIRT725412	hsa-miR-3942-3p	HITS-CLIP	19536157
MIRT725411	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT725410	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT725409	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT557203	hsa-miR-548c-3p	HITS-CLIP	22927820
MIRT135086	hsa-miR-548av-3p	HITS-CLIP	22927820
MIRT135069	hsa-miR-548g-3p	HITS-CLIP	22927820
MIRT706094	hsa-miR-888-3p	HITS-CLIP	22927820
MIRT706093	hsa-miR-4728-3p	HITS-CLIP	22927820
MIRT557201	hsa-miR-3613-3p	HITS-CLIP	22927820
MIRT706092	hsa-miR-4536-3p	HITS-CLIP	22927820
MIRT706091	hsa-miR-6730-3p	HITS-CLIP	22927820
MIRT706090	hsa-miR-7162-3p	HITS-CLIP	22927820
MIRT706089	hsa-miR-642a-3p	HITS-CLIP	22927820
MIRT706088	hsa-miR-642b-3p	HITS-CLIP	22927820
MIRT706087	hsa-miR-655-5p	HITS-CLIP	22927820
MIRT706086	hsa-miR-377-5p	HITS-CLIP	22927820
MIRT706085	hsa-miR-6086	HITS-CLIP	22927820
MIRT706084	hsa-miR-4663	HITS-CLIP	22927820
MIRT706083	hsa-miR-7160-5p	HITS-CLIP	22927820
MIRT706082	hsa-miR-8077	HITS-CLIP	22927820
MIRT706081	hsa-miR-597-3p	HITS-CLIP	22927820
MIRT706080	hsa-miR-2117	HITS-CLIP	22927820
MIRT706079	hsa-miR-517a-3p	HITS-CLIP	22927820
MIRT706078	hsa-miR-517b-3p	HITS-CLIP	22927820
MIRT706077	hsa-miR-517c-3p	HITS-CLIP	22927820
MIRT706076	hsa-miR-4753-3p	HITS-CLIP	22927820
MIRT186644	hsa-let-7c-3p	HITS-CLIP	22927820
MIRT706075	hsa-miR-6809-3p	HITS-CLIP	22927820
MIRT557200	hsa-miR-548ae-3p	HITS-CLIP	22927820
MIRT557199	hsa-miR-548aj-3p	HITS-CLIP	22927820
MIRT557198	hsa-miR-548aq-3p	HITS-CLIP	22927820
MIRT557197	hsa-miR-548x-3p	HITS-CLIP	22927820
MIRT113132	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT511454	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT511452	hsa-miR-5094	PAR-CLIP	20371350
MIRT511453	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT511451	hsa-miR-4277	PAR-CLIP	20371350
MIRT511450	hsa-miR-6505-3p	PAR-CLIP	20371350
MIRT511449	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT511448	hsa-miR-3924	PAR-CLIP	20371350
MIRT511447	hsa-miR-4531	PAR-CLIP	20371350
MIRT511446	hsa-miR-1270	PAR-CLIP	20371350
MIRT511445	hsa-miR-620	PAR-CLIP	20371350
MIRT113135	hsa-miR-3611	PAR-CLIP	20371350
MIRT511444	hsa-miR-578	PAR-CLIP	20371350
MIRT511443	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT113132	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT511454	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT511452	hsa-miR-5094	PAR-CLIP	21572407
MIRT511453	hsa-miR-584-3p	PAR-CLIP	21572407
MIRT511451	hsa-miR-4277	PAR-CLIP	21572407
MIRT511450	hsa-miR-6505-3p	PAR-CLIP	21572407
MIRT511449	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT511448	hsa-miR-3924	PAR-CLIP	21572407
MIRT511447	hsa-miR-4531	PAR-CLIP	21572407
MIRT511446	hsa-miR-1270	PAR-CLIP	21572407
MIRT511445	hsa-miR-620	PAR-CLIP	21572407
MIRT113135	hsa-miR-3611	PAR-CLIP	21572407
MIRT511444	hsa-miR-578	PAR-CLIP	21572407
MIRT511443	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT557203	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT135086	hsa-miR-548av-3p	PAR-CLIP	21572407
MIRT135069	hsa-miR-548g-3p	PAR-CLIP	21572407
MIRT557202	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT557201	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT186644	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT557200	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT557199	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT557198	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT557197	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT113132	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT511454	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT511452	hsa-miR-5094	PAR-CLIP	21572407
MIRT511453	hsa-miR-584-3p	PAR-CLIP	21572407
MIRT511451	hsa-miR-4277	PAR-CLIP	21572407
MIRT511450	hsa-miR-6505-3p	PAR-CLIP	21572407
MIRT511449	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT547923	hsa-miR-4434	PAR-CLIP	21572407
MIRT547921	hsa-miR-4516	PAR-CLIP	21572407
MIRT547922	hsa-miR-5703	PAR-CLIP	21572407
MIRT511448	hsa-miR-3924	PAR-CLIP	21572407
MIRT511447	hsa-miR-4531	PAR-CLIP	21572407
MIRT511446	hsa-miR-1270	PAR-CLIP	21572407
MIRT511445	hsa-miR-620	PAR-CLIP	21572407
MIRT113135	hsa-miR-3611	PAR-CLIP	21572407
MIRT511444	hsa-miR-578	PAR-CLIP	21572407
MIRT511443	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT547920	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT547919	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547918	hsa-miR-34a-3p	PAR-CLIP	21572407
MIRT547917	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT547916	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523154	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT045256	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT523153	hsa-miR-3133	PAR-CLIP	23446348
MIRT523152	hsa-miR-320e	PAR-CLIP	23446348
MIRT523151	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT523150	hsa-miR-198	PAR-CLIP	23446348
MIRT523149	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT523148	hsa-miR-7159-3p	PAR-CLIP	23446348
MIRT113132	hsa-miR-493-3p	PAR-CLIP	23446348
MIRT511454	hsa-miR-329-5p	PAR-CLIP	23446348
MIRT511452	hsa-miR-5094	PAR-CLIP	23446348
MIRT511453	hsa-miR-584-3p	PAR-CLIP	23446348
MIRT511451	hsa-miR-4277	PAR-CLIP	23446348
MIRT511450	hsa-miR-6505-3p	PAR-CLIP	23446348
MIRT511449	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT511448	hsa-miR-3924	PAR-CLIP	23446348
MIRT511447	hsa-miR-4531	PAR-CLIP	23446348
MIRT511446	hsa-miR-1270	PAR-CLIP	23446348
MIRT511445	hsa-miR-620	PAR-CLIP	23446348
MIRT113135	hsa-miR-3611	PAR-CLIP	23446348
MIRT511444	hsa-miR-578	PAR-CLIP	23446348
MIRT511443	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT475554	hsa-miR-3662	PAR-CLIP	23592263
MIRT475553	hsa-miR-6732-3p	PAR-CLIP	23592263
MIRT475552	hsa-miR-5683	PAR-CLIP	23592263
MIRT475551	hsa-miR-577	PAR-CLIP	23592263
MIRT475550	hsa-miR-3163	PAR-CLIP	23592263
MIRT475549	hsa-miR-3668	PAR-CLIP	23592263
MIRT1051934	hsa-miR-106a	CLIP-seq
MIRT1051935	hsa-miR-106b	CLIP-seq
MIRT1051936	hsa-miR-1245b-5p	CLIP-seq
MIRT1051937	hsa-miR-1262	CLIP-seq
MIRT1051938	hsa-miR-132	CLIP-seq
MIRT1051939	hsa-miR-17	CLIP-seq
MIRT1051940	hsa-miR-186	CLIP-seq
MIRT1051941	hsa-miR-1972	CLIP-seq
MIRT1051942	hsa-miR-19a	CLIP-seq
MIRT1051943	hsa-miR-19b	CLIP-seq
MIRT1051944	hsa-miR-205	CLIP-seq
MIRT1051945	hsa-miR-20a	CLIP-seq
MIRT1051946	hsa-miR-20b	CLIP-seq
MIRT1051947	hsa-miR-21	CLIP-seq
MIRT1051948	hsa-miR-212	CLIP-seq
MIRT1051949	hsa-miR-23a	CLIP-seq
MIRT1051950	hsa-miR-23b	CLIP-seq
MIRT1051951	hsa-miR-23c	CLIP-seq
MIRT1051952	hsa-miR-25	CLIP-seq
MIRT1051953	hsa-miR-3142	CLIP-seq
MIRT1051954	hsa-miR-3143	CLIP-seq
MIRT1051955	hsa-miR-3160-5p	CLIP-seq
MIRT1051956	hsa-miR-3184	CLIP-seq
MIRT1051957	hsa-miR-32	CLIP-seq
MIRT1051958	hsa-miR-3609	CLIP-seq
MIRT1051959	hsa-miR-363	CLIP-seq
MIRT1051960	hsa-miR-367	CLIP-seq
MIRT1051961	hsa-miR-423-5p	CLIP-seq
MIRT1051962	hsa-miR-4255	CLIP-seq
MIRT1051963	hsa-miR-4271	CLIP-seq
MIRT1051964	hsa-miR-4278	CLIP-seq
MIRT1051965	hsa-miR-4282	CLIP-seq
MIRT1051966	hsa-miR-4310	CLIP-seq
MIRT1051967	hsa-miR-4506	CLIP-seq
MIRT1051968	hsa-miR-4650-5p	CLIP-seq
MIRT1051969	hsa-miR-4662a-3p	CLIP-seq
MIRT1051970	hsa-miR-4676-5p	CLIP-seq
MIRT1051971	hsa-miR-4694-3p	CLIP-seq
MIRT1051972	hsa-miR-4699-5p	CLIP-seq
MIRT1051973	hsa-miR-4701-3p	CLIP-seq
MIRT1051974	hsa-miR-4710	CLIP-seq
MIRT1051975	hsa-miR-4714-3p	CLIP-seq
MIRT1051976	hsa-miR-4725-3p	CLIP-seq
MIRT1051977	hsa-miR-4744	CLIP-seq
MIRT1051978	hsa-miR-4792	CLIP-seq
MIRT1051979	hsa-miR-4796-3p	CLIP-seq
MIRT1051980	hsa-miR-493	CLIP-seq
MIRT1051981	hsa-miR-512-5p	CLIP-seq
MIRT1051982	hsa-miR-517a	CLIP-seq
MIRT1051983	hsa-miR-517b	CLIP-seq
MIRT1051984	hsa-miR-517c	CLIP-seq
MIRT1051985	hsa-miR-519d	CLIP-seq
MIRT1051986	hsa-miR-522	CLIP-seq
MIRT1051987	hsa-miR-539	CLIP-seq
MIRT1051988	hsa-miR-548ah	CLIP-seq
MIRT1051989	hsa-miR-570	CLIP-seq
MIRT1051990	hsa-miR-575	CLIP-seq
MIRT1051991	hsa-miR-581	CLIP-seq
MIRT1051992	hsa-miR-590-5p	CLIP-seq
MIRT1051993	hsa-miR-642b	CLIP-seq
MIRT1051994	hsa-miR-92a	CLIP-seq
MIRT1051995	hsa-miR-92b	CLIP-seq
MIRT1051996	hsa-miR-93	CLIP-seq
MIRT1051997	hsa-miR-1	CLIP-seq
MIRT1051998	hsa-miR-101	CLIP-seq
MIRT1051934	hsa-miR-106a	CLIP-seq
MIRT1051935	hsa-miR-106b	CLIP-seq
MIRT1051999	hsa-miR-1200	CLIP-seq
MIRT1052000	hsa-miR-1225-5p	CLIP-seq
MIRT1052001	hsa-miR-1238	CLIP-seq
MIRT1052002	hsa-miR-1245	CLIP-seq
MIRT1052003	hsa-miR-1255a	CLIP-seq
MIRT1052004	hsa-miR-1255b	CLIP-seq
MIRT1052005	hsa-miR-1260	CLIP-seq
MIRT1052006	hsa-miR-1260b	CLIP-seq
MIRT1052007	hsa-miR-1290	CLIP-seq
MIRT1052008	hsa-miR-1301	CLIP-seq
MIRT1052009	hsa-miR-1305	CLIP-seq
MIRT1051938	hsa-miR-132	CLIP-seq
MIRT1052010	hsa-miR-135a	CLIP-seq
MIRT1052011	hsa-miR-135b	CLIP-seq
MIRT1052012	hsa-miR-137	CLIP-seq
MIRT1052013	hsa-miR-139-5p	CLIP-seq
MIRT1052014	hsa-miR-144	CLIP-seq
MIRT1051939	hsa-miR-17	CLIP-seq
MIRT1052015	hsa-miR-188-3p	CLIP-seq
MIRT1052016	hsa-miR-1910	CLIP-seq
MIRT1052017	hsa-miR-1912	CLIP-seq
MIRT1051942	hsa-miR-19a	CLIP-seq
MIRT1051943	hsa-miR-19b	CLIP-seq
MIRT1052018	hsa-miR-206	CLIP-seq
MIRT1051945	hsa-miR-20a	CLIP-seq
MIRT1051946	hsa-miR-20b	CLIP-seq
MIRT1051947	hsa-miR-21	CLIP-seq
MIRT1052019	hsa-miR-2114	CLIP-seq
MIRT1051948	hsa-miR-212	CLIP-seq
MIRT1052020	hsa-miR-214	CLIP-seq
MIRT1052021	hsa-miR-2355-3p	CLIP-seq
MIRT1052022	hsa-miR-2392	CLIP-seq
MIRT1051952	hsa-miR-25	CLIP-seq
MIRT1052023	hsa-miR-298	CLIP-seq
MIRT1052024	hsa-miR-3126-5p	CLIP-seq
MIRT1052025	hsa-miR-3130-5p	CLIP-seq
MIRT1052026	hsa-miR-3132	CLIP-seq
MIRT1052027	hsa-miR-3144-3p	CLIP-seq
MIRT1052028	hsa-miR-3148	CLIP-seq
MIRT1052029	hsa-miR-3156-3p	CLIP-seq
MIRT1051955	hsa-miR-3160-5p	CLIP-seq
MIRT1052030	hsa-miR-3165	CLIP-seq
MIRT1052031	hsa-miR-3167	CLIP-seq
MIRT1052032	hsa-miR-3173-3p	CLIP-seq
MIRT1051956	hsa-miR-3184	CLIP-seq
MIRT1052033	hsa-miR-3190	CLIP-seq
MIRT1051957	hsa-miR-32	CLIP-seq
MIRT1052034	hsa-miR-326	CLIP-seq
MIRT1052035	hsa-miR-330-3p	CLIP-seq
MIRT1052036	hsa-miR-330-5p	CLIP-seq
MIRT1052037	hsa-miR-340	CLIP-seq
MIRT1052038	hsa-miR-3605-5p	CLIP-seq
MIRT1051958	hsa-miR-3609	CLIP-seq
MIRT1052039	hsa-miR-3619-5p	CLIP-seq
MIRT1051959	hsa-miR-363	CLIP-seq
MIRT1052040	hsa-miR-3646	CLIP-seq
MIRT1052041	hsa-miR-3653	CLIP-seq
MIRT1052042	hsa-miR-3658	CLIP-seq
MIRT1051960	hsa-miR-367	CLIP-seq
MIRT1052043	hsa-miR-3670	CLIP-seq
MIRT1052044	hsa-miR-3673	CLIP-seq
MIRT1052045	hsa-miR-3688-3p	CLIP-seq
MIRT1052046	hsa-miR-3691-3p	CLIP-seq
MIRT1052047	hsa-miR-3692	CLIP-seq
MIRT1052048	hsa-miR-3913-3p	CLIP-seq
MIRT1052049	hsa-miR-3914	CLIP-seq
MIRT1052050	hsa-miR-3942-5p	CLIP-seq
MIRT1052051	hsa-miR-409-3p	CLIP-seq
MIRT1051961	hsa-miR-423-5p	CLIP-seq
MIRT1051962	hsa-miR-4255	CLIP-seq
MIRT1052052	hsa-miR-4258	CLIP-seq
MIRT1052053	hsa-miR-4269	CLIP-seq
MIRT1051963	hsa-miR-4271	CLIP-seq
MIRT1052054	hsa-miR-4274	CLIP-seq
MIRT1052055	hsa-miR-4291	CLIP-seq
MIRT1052056	hsa-miR-4301	CLIP-seq
MIRT1052057	hsa-miR-4324	CLIP-seq
MIRT1052058	hsa-miR-4327	CLIP-seq
MIRT1052059	hsa-miR-4419a	CLIP-seq
MIRT1052060	hsa-miR-4424	CLIP-seq
MIRT1052061	hsa-miR-4426	CLIP-seq
MIRT1052062	hsa-miR-4428	CLIP-seq
MIRT1052063	hsa-miR-4457	CLIP-seq
MIRT1052064	hsa-miR-4482	CLIP-seq
MIRT1052065	hsa-miR-4510	CLIP-seq
MIRT1052066	hsa-miR-4519	CLIP-seq
MIRT1052067	hsa-miR-4521	CLIP-seq
MIRT1052068	hsa-miR-4524	CLIP-seq
MIRT1052069	hsa-miR-4533	CLIP-seq
MIRT1052070	hsa-miR-455-3p	CLIP-seq
MIRT1052071	hsa-miR-4640-3p	CLIP-seq
MIRT1052072	hsa-miR-4646-3p	CLIP-seq
MIRT1052073	hsa-miR-4647	CLIP-seq
MIRT1052074	hsa-miR-4653-3p	CLIP-seq
MIRT1052075	hsa-miR-4660	CLIP-seq
MIRT1052076	hsa-miR-4662b	CLIP-seq
MIRT1052077	hsa-miR-4668-5p	CLIP-seq
MIRT1051970	hsa-miR-4676-5p	CLIP-seq
MIRT1052078	hsa-miR-4690-5p	CLIP-seq
MIRT1051971	hsa-miR-4694-3p	CLIP-seq
MIRT1052079	hsa-miR-4698	CLIP-seq
MIRT1051972	hsa-miR-4699-5p	CLIP-seq
MIRT1052080	hsa-miR-4703-5p	CLIP-seq
MIRT1052081	hsa-miR-4704-5p	CLIP-seq
MIRT1051976	hsa-miR-4725-3p	CLIP-seq
MIRT1052082	hsa-miR-4733-5p	CLIP-seq
MIRT1052083	hsa-miR-4747-5p	CLIP-seq
MIRT1052084	hsa-miR-4752	CLIP-seq
MIRT1052085	hsa-miR-4757-5p	CLIP-seq
MIRT1051979	hsa-miR-4796-3p	CLIP-seq
MIRT1052086	hsa-miR-4797-5p	CLIP-seq
MIRT1052087	hsa-miR-489	CLIP-seq
MIRT1051980	hsa-miR-493	CLIP-seq
MIRT1052088	hsa-miR-495	CLIP-seq
MIRT1052089	hsa-miR-5047	CLIP-seq
MIRT1052090	hsa-miR-513b	CLIP-seq
MIRT1051982	hsa-miR-517a	CLIP-seq
MIRT1051983	hsa-miR-517b	CLIP-seq
MIRT1051984	hsa-miR-517c	CLIP-seq
MIRT1052091	hsa-miR-518a-5p	CLIP-seq
MIRT1051985	hsa-miR-519d	CLIP-seq
MIRT1052092	hsa-miR-520d-5p	CLIP-seq
MIRT1052093	hsa-miR-524-5p	CLIP-seq
MIRT1052094	hsa-miR-527	CLIP-seq
MIRT1051987	hsa-miR-539	CLIP-seq
MIRT1052095	hsa-miR-544b	CLIP-seq
MIRT1052096	hsa-miR-545	CLIP-seq
MIRT1052097	hsa-miR-548aa	CLIP-seq
MIRT1052098	hsa-miR-548ac	CLIP-seq
MIRT1051988	hsa-miR-548ah	CLIP-seq
MIRT1052099	hsa-miR-548d-3p	CLIP-seq
MIRT1052100	hsa-miR-548g	CLIP-seq
MIRT1052101	hsa-miR-548v	CLIP-seq
MIRT1052102	hsa-miR-548z	CLIP-seq
MIRT1051989	hsa-miR-570	CLIP-seq
MIRT1051990	hsa-miR-575	CLIP-seq
MIRT1051991	hsa-miR-581	CLIP-seq
MIRT1052103	hsa-miR-584	CLIP-seq
MIRT1051992	hsa-miR-590-5p	CLIP-seq
MIRT1052104	hsa-miR-591	CLIP-seq
MIRT1052105	hsa-miR-606	CLIP-seq
MIRT1052106	hsa-miR-613	CLIP-seq
MIRT1051993	hsa-miR-642b	CLIP-seq
MIRT1052107	hsa-miR-660	CLIP-seq
MIRT1052108	hsa-miR-759	CLIP-seq
MIRT1052109	hsa-miR-761	CLIP-seq
MIRT1052110	hsa-miR-876-5p	CLIP-seq
MIRT1052111	hsa-miR-885-5p	CLIP-seq
MIRT1052112	hsa-miR-892b	CLIP-seq
MIRT1052113	hsa-miR-922	CLIP-seq
MIRT1051994	hsa-miR-92a	CLIP-seq
MIRT1051995	hsa-miR-92b	CLIP-seq
MIRT1051996	hsa-miR-93	CLIP-seq
MIRT1051987	hsa-miR-539	CLIP-seq
MIRT1922100	hsa-miR-1193	CLIP-seq
MIRT1051999	hsa-miR-1200	CLIP-seq
MIRT1052002	hsa-miR-1245	CLIP-seq
MIRT1052022	hsa-miR-2392	CLIP-seq
MIRT1052043	hsa-miR-3670	CLIP-seq
MIRT1922101	hsa-miR-371-5p	CLIP-seq
MIRT1922102	hsa-miR-371b-5p	CLIP-seq
MIRT1052052	hsa-miR-4258	CLIP-seq
MIRT1052057	hsa-miR-4324	CLIP-seq
MIRT1922103	hsa-miR-4423-5p	CLIP-seq
MIRT1922104	hsa-miR-4781-3p	CLIP-seq
MIRT1052095	hsa-miR-544b	CLIP-seq
MIRT1051997	hsa-miR-1	CLIP-seq
MIRT2011794	hsa-miR-1224-5p	CLIP-seq
MIRT1052000	hsa-miR-1225-5p	CLIP-seq
MIRT1052001	hsa-miR-1238	CLIP-seq
MIRT2011795	hsa-miR-1243	CLIP-seq
MIRT2011796	hsa-miR-1267	CLIP-seq
MIRT1052007	hsa-miR-1290	CLIP-seq
MIRT1051938	hsa-miR-132	CLIP-seq
MIRT2011797	hsa-miR-155	CLIP-seq
MIRT1051940	hsa-miR-186	CLIP-seq
MIRT2011798	hsa-miR-200b	CLIP-seq
MIRT2011799	hsa-miR-200c	CLIP-seq
MIRT1052018	hsa-miR-206	CLIP-seq
MIRT1051947	hsa-miR-21	CLIP-seq
MIRT1051948	hsa-miR-212	CLIP-seq
MIRT1052022	hsa-miR-2392	CLIP-seq
MIRT1052023	hsa-miR-298	CLIP-seq
MIRT2011800	hsa-miR-3117-5p	CLIP-seq
MIRT2011801	hsa-miR-3129-3p	CLIP-seq
MIRT1051954	hsa-miR-3143	CLIP-seq
MIRT1052028	hsa-miR-3148	CLIP-seq
MIRT1052031	hsa-miR-3167	CLIP-seq
MIRT2011802	hsa-miR-3182	CLIP-seq
MIRT1052033	hsa-miR-3190	CLIP-seq
MIRT1052035	hsa-miR-330-3p	CLIP-seq
MIRT2011803	hsa-miR-335	CLIP-seq
MIRT2011804	hsa-miR-3655	CLIP-seq
MIRT1052044	hsa-miR-3673	CLIP-seq
MIRT2011805	hsa-miR-3682-5p	CLIP-seq
MIRT1052045	hsa-miR-3688-3p	CLIP-seq
MIRT2011806	hsa-miR-3689a-5p	CLIP-seq
MIRT2011807	hsa-miR-3689b	CLIP-seq
MIRT2011808	hsa-miR-3689e	CLIP-seq
MIRT2011809	hsa-miR-3689f	CLIP-seq
MIRT1922101	hsa-miR-371-5p	CLIP-seq
MIRT1922102	hsa-miR-371b-5p	CLIP-seq
MIRT2011810	hsa-miR-376c	CLIP-seq
MIRT1052053	hsa-miR-4269	CLIP-seq
MIRT1051963	hsa-miR-4271	CLIP-seq
MIRT1052054	hsa-miR-4274	CLIP-seq
MIRT2011811	hsa-miR-429	CLIP-seq
MIRT2011812	hsa-miR-433	CLIP-seq
MIRT2011813	hsa-miR-4423-3p	CLIP-seq
MIRT2011814	hsa-miR-4438	CLIP-seq
MIRT2011815	hsa-miR-4452	CLIP-seq
MIRT1052063	hsa-miR-4457	CLIP-seq
MIRT2011816	hsa-miR-4517	CLIP-seq
MIRT1052066	hsa-miR-4519	CLIP-seq
MIRT1052067	hsa-miR-4521	CLIP-seq
MIRT2011817	hsa-miR-4540	CLIP-seq
MIRT2011818	hsa-miR-4639-5p	CLIP-seq
MIRT2011819	hsa-miR-4652-3p	CLIP-seq
MIRT2011820	hsa-miR-4666-5p	CLIP-seq
MIRT2011821	hsa-miR-4677-3p	CLIP-seq
MIRT2011822	hsa-miR-4679	CLIP-seq
MIRT1051971	hsa-miR-4694-3p	CLIP-seq
MIRT1052079	hsa-miR-4698	CLIP-seq
MIRT2011823	hsa-miR-4719	CLIP-seq
MIRT1051976	hsa-miR-4725-3p	CLIP-seq
MIRT2011824	hsa-miR-4733-3p	CLIP-seq
MIRT1051977	hsa-miR-4744	CLIP-seq
MIRT2011825	hsa-miR-4751	CLIP-seq
MIRT1052084	hsa-miR-4752	CLIP-seq
MIRT2011826	hsa-miR-4760-3p	CLIP-seq
MIRT1922104	hsa-miR-4781-3p	CLIP-seq
MIRT2011827	hsa-miR-4786-5p	CLIP-seq
MIRT2011828	hsa-miR-5095	CLIP-seq
MIRT2011829	hsa-miR-513a-3p	CLIP-seq
MIRT1052090	hsa-miR-513b	CLIP-seq
MIRT2011830	hsa-miR-513c	CLIP-seq
MIRT2011831	hsa-miR-514b-5p	CLIP-seq
MIRT1051982	hsa-miR-517a	CLIP-seq
MIRT1051983	hsa-miR-517b	CLIP-seq
MIRT1051984	hsa-miR-517c	CLIP-seq
MIRT1052092	hsa-miR-520d-5p	CLIP-seq
MIRT1052093	hsa-miR-524-5p	CLIP-seq
MIRT1051987	hsa-miR-539	CLIP-seq
MIRT2011832	hsa-miR-543	CLIP-seq
MIRT1052100	hsa-miR-548g	CLIP-seq
MIRT1052101	hsa-miR-548v	CLIP-seq
MIRT2011833	hsa-miR-549	CLIP-seq
MIRT1051989	hsa-miR-570	CLIP-seq
MIRT1051991	hsa-miR-581	CLIP-seq
MIRT1052103	hsa-miR-584	CLIP-seq
MIRT1051992	hsa-miR-590-5p	CLIP-seq
MIRT1052106	hsa-miR-613	CLIP-seq
MIRT2011834	hsa-miR-616	CLIP-seq
MIRT1051993	hsa-miR-642b	CLIP-seq
MIRT1052110	hsa-miR-876-5p	CLIP-seq
MIRT2244084	hsa-miR-129-3p	CLIP-seq
MIRT1052014	hsa-miR-144	CLIP-seq
MIRT2244085	hsa-miR-150	CLIP-seq
MIRT2011798	hsa-miR-200b	CLIP-seq
MIRT2011799	hsa-miR-200c	CLIP-seq
MIRT1051947	hsa-miR-21	CLIP-seq
MIRT1051949	hsa-miR-23a	CLIP-seq
MIRT1051950	hsa-miR-23b	CLIP-seq
MIRT1051951	hsa-miR-23c	CLIP-seq
MIRT1051952	hsa-miR-25	CLIP-seq
MIRT1051957	hsa-miR-32	CLIP-seq
MIRT1051959	hsa-miR-363	CLIP-seq
MIRT1051960	hsa-miR-367	CLIP-seq
MIRT1051963	hsa-miR-4271	CLIP-seq
MIRT1052054	hsa-miR-4274	CLIP-seq
MIRT2011811	hsa-miR-429	CLIP-seq
MIRT1052066	hsa-miR-4519	CLIP-seq
MIRT1052074	hsa-miR-4653-3p	CLIP-seq
MIRT1051970	hsa-miR-4676-5p	CLIP-seq
MIRT1052081	hsa-miR-4704-5p	CLIP-seq
MIRT1051976	hsa-miR-4725-3p	CLIP-seq
MIRT1051977	hsa-miR-4744	CLIP-seq
MIRT2244086	hsa-miR-4775	CLIP-seq
MIRT2011833	hsa-miR-549	CLIP-seq
MIRT1051989	hsa-miR-570	CLIP-seq
MIRT1051990	hsa-miR-575	CLIP-seq
MIRT2244087	hsa-miR-590-3p	CLIP-seq
MIRT1051992	hsa-miR-590-5p	CLIP-seq
MIRT1052107	hsa-miR-660	CLIP-seq
MIRT1051994	hsa-miR-92a	CLIP-seq
MIRT1051995	hsa-miR-92b	CLIP-seq
MIRT1051934	hsa-miR-106a	CLIP-seq
MIRT1051935	hsa-miR-106b	CLIP-seq
MIRT2244088	hsa-miR-1273e	CLIP-seq
MIRT2244089	hsa-miR-1321	CLIP-seq
MIRT1052014	hsa-miR-144	CLIP-seq
MIRT2244085	hsa-miR-150	CLIP-seq
MIRT1051939	hsa-miR-17	CLIP-seq
MIRT1052017	hsa-miR-1912	CLIP-seq
MIRT1051945	hsa-miR-20a	CLIP-seq
MIRT1051946	hsa-miR-20b	CLIP-seq
MIRT1051947	hsa-miR-21	CLIP-seq
MIRT1052021	hsa-miR-2355-3p	CLIP-seq
MIRT1052022	hsa-miR-2392	CLIP-seq
MIRT1051949	hsa-miR-23a	CLIP-seq
MIRT1051950	hsa-miR-23b	CLIP-seq
MIRT1051951	hsa-miR-23c	CLIP-seq
MIRT2244090	hsa-miR-302a	CLIP-seq
MIRT2244091	hsa-miR-302b	CLIP-seq
MIRT2244092	hsa-miR-302c	CLIP-seq
MIRT2244093	hsa-miR-302d	CLIP-seq
MIRT2244094	hsa-miR-302e	CLIP-seq
MIRT2011800	hsa-miR-3117-5p	CLIP-seq
MIRT2011801	hsa-miR-3129-3p	CLIP-seq
MIRT1052025	hsa-miR-3130-5p	CLIP-seq
MIRT1052026	hsa-miR-3132	CLIP-seq
MIRT2244095	hsa-miR-3162-5p	CLIP-seq
MIRT2011805	hsa-miR-3682-5p	CLIP-seq
MIRT2244096	hsa-miR-372	CLIP-seq
MIRT2244097	hsa-miR-373	CLIP-seq
MIRT2244098	hsa-miR-410	CLIP-seq
MIRT1051962	hsa-miR-4255	CLIP-seq
MIRT1052052	hsa-miR-4258	CLIP-seq
MIRT1051963	hsa-miR-4271	CLIP-seq
MIRT1052054	hsa-miR-4274	CLIP-seq
MIRT1051965	hsa-miR-4282	CLIP-seq
MIRT1052058	hsa-miR-4327	CLIP-seq
MIRT2244099	hsa-miR-4422	CLIP-seq
MIRT1052061	hsa-miR-4426	CLIP-seq
MIRT1052064	hsa-miR-4482	CLIP-seq
MIRT1052066	hsa-miR-4519	CLIP-seq
MIRT1052067	hsa-miR-4521	CLIP-seq
MIRT1052072	hsa-miR-4646-3p	CLIP-seq
MIRT1052073	hsa-miR-4647	CLIP-seq
MIRT2244100	hsa-miR-4659a-5p	CLIP-seq
MIRT2244101	hsa-miR-4659b-5p	CLIP-seq
MIRT1052076	hsa-miR-4662b	CLIP-seq
MIRT1052081	hsa-miR-4704-5p	CLIP-seq
MIRT1051976	hsa-miR-4725-3p	CLIP-seq
MIRT2244102	hsa-miR-4739	CLIP-seq
MIRT2244103	hsa-miR-4756-5p	CLIP-seq
MIRT1052085	hsa-miR-4757-5p	CLIP-seq
MIRT2011826	hsa-miR-4760-3p	CLIP-seq
MIRT2244086	hsa-miR-4775	CLIP-seq
MIRT2244104	hsa-miR-4776-3p	CLIP-seq
MIRT1052086	hsa-miR-4797-5p	CLIP-seq
MIRT2244105	hsa-miR-487a	CLIP-seq
MIRT1051982	hsa-miR-517a	CLIP-seq
MIRT1051983	hsa-miR-517b	CLIP-seq
MIRT1051984	hsa-miR-517c	CLIP-seq
MIRT1051985	hsa-miR-519d	CLIP-seq
MIRT2244106	hsa-miR-520a-3p	CLIP-seq
MIRT2244107	hsa-miR-520b	CLIP-seq
MIRT2244108	hsa-miR-520c-3p	CLIP-seq
MIRT2244109	hsa-miR-520d-3p	CLIP-seq
MIRT2244110	hsa-miR-520e	CLIP-seq
MIRT2244111	hsa-miR-520g	CLIP-seq
MIRT2244112	hsa-miR-520h	CLIP-seq
MIRT1052096	hsa-miR-545	CLIP-seq
MIRT1052100	hsa-miR-548g	CLIP-seq
MIRT2011833	hsa-miR-549	CLIP-seq
MIRT1051991	hsa-miR-581	CLIP-seq
MIRT2244087	hsa-miR-590-3p	CLIP-seq
MIRT1051992	hsa-miR-590-5p	CLIP-seq
MIRT1052105	hsa-miR-606	CLIP-seq
MIRT1051993	hsa-miR-642b	CLIP-seq
MIRT1052108	hsa-miR-759	CLIP-seq
MIRT1051996	hsa-miR-93	CLIP-seq
MIRT2244113	hsa-miR-944	CLIP-seq
MIRT2011833	hsa-miR-549	CLIP-seq
MIRT2011798	hsa-miR-200b	CLIP-seq
MIRT2011799	hsa-miR-200c	CLIP-seq
MIRT1051949	hsa-miR-23a	CLIP-seq
MIRT1051950	hsa-miR-23b	CLIP-seq
MIRT1051951	hsa-miR-23c	CLIP-seq
MIRT1051954	hsa-miR-3143	CLIP-seq
MIRT1051956	hsa-miR-3184	CLIP-seq
MIRT1051961	hsa-miR-423-5p	CLIP-seq
MIRT1051962	hsa-miR-4255	CLIP-seq
MIRT2011811	hsa-miR-429	CLIP-seq
MIRT2011812	hsa-miR-433	CLIP-seq
MIRT1051974	hsa-miR-4710	CLIP-seq
MIRT1051978	hsa-miR-4792	CLIP-seq
MIRT1051982	hsa-miR-517a	CLIP-seq
MIRT1051983	hsa-miR-517b	CLIP-seq
MIRT1051984	hsa-miR-517c	CLIP-seq
MIRT1052092	hsa-miR-520d-5p	CLIP-seq
MIRT1052093	hsa-miR-524-5p	CLIP-seq
MIRT1052100	hsa-miR-548g	CLIP-seq
MIRT1051993	hsa-miR-642b	CLIP-seq
MIRT1051982	hsa-miR-517a	CLIP-seq
MIRT1051983	hsa-miR-517b	CLIP-seq
MIRT1051984	hsa-miR-517c	CLIP-seq
MIRT1051993	hsa-miR-642b	CLIP-seq
MIRT1051998	hsa-miR-101	CLIP-seq
MIRT2547124	hsa-miR-122	CLIP-seq
MIRT2011794	hsa-miR-1224-5p	CLIP-seq
MIRT2011795	hsa-miR-1243	CLIP-seq
MIRT1052007	hsa-miR-1290	CLIP-seq
MIRT1052014	hsa-miR-144	CLIP-seq
MIRT2011797	hsa-miR-155	CLIP-seq
MIRT1052017	hsa-miR-1912	CLIP-seq
MIRT2547125	hsa-miR-2054	CLIP-seq
MIRT1051947	hsa-miR-21	CLIP-seq
MIRT1052022	hsa-miR-2392	CLIP-seq
MIRT1052023	hsa-miR-298	CLIP-seq
MIRT1052025	hsa-miR-3130-5p	CLIP-seq
MIRT1051954	hsa-miR-3143	CLIP-seq
MIRT1052028	hsa-miR-3148	CLIP-seq
MIRT1051955	hsa-miR-3160-5p	CLIP-seq
MIRT1052030	hsa-miR-3165	CLIP-seq
MIRT1052031	hsa-miR-3167	CLIP-seq
MIRT1052038	hsa-miR-3605-5p	CLIP-seq
MIRT1052045	hsa-miR-3688-3p	CLIP-seq
MIRT1052049	hsa-miR-3914	CLIP-seq
MIRT2011812	hsa-miR-433	CLIP-seq
MIRT1052060	hsa-miR-4424	CLIP-seq
MIRT1052061	hsa-miR-4426	CLIP-seq
MIRT2547126	hsa-miR-4468	CLIP-seq
MIRT1052064	hsa-miR-4482	CLIP-seq
MIRT2547127	hsa-miR-4504	CLIP-seq
MIRT2011816	hsa-miR-4517	CLIP-seq
MIRT2547128	hsa-miR-4534	CLIP-seq
MIRT2011817	hsa-miR-4540	CLIP-seq
MIRT2011818	hsa-miR-4639-5p	CLIP-seq
MIRT1052071	hsa-miR-4640-3p	CLIP-seq
MIRT1052073	hsa-miR-4647	CLIP-seq
MIRT1052074	hsa-miR-4653-3p	CLIP-seq
MIRT1052076	hsa-miR-4662b	CLIP-seq
MIRT2011820	hsa-miR-4666-5p	CLIP-seq
MIRT2011821	hsa-miR-4677-3p	CLIP-seq
MIRT2011822	hsa-miR-4679	CLIP-seq
MIRT1051971	hsa-miR-4694-3p	CLIP-seq
MIRT1052079	hsa-miR-4698	CLIP-seq
MIRT1052081	hsa-miR-4704-5p	CLIP-seq
MIRT2011825	hsa-miR-4751	CLIP-seq
MIRT2011826	hsa-miR-4760-3p	CLIP-seq
MIRT1052086	hsa-miR-4797-5p	CLIP-seq
MIRT2547129	hsa-miR-4799-5p	CLIP-seq
MIRT1051982	hsa-miR-517a	CLIP-seq
MIRT1051983	hsa-miR-517b	CLIP-seq
MIRT1051984	hsa-miR-517c	CLIP-seq
MIRT1052092	hsa-miR-520d-5p	CLIP-seq
MIRT1052093	hsa-miR-524-5p	CLIP-seq
MIRT1051987	hsa-miR-539	CLIP-seq
MIRT2547130	hsa-miR-542-3p	CLIP-seq
MIRT2011832	hsa-miR-543	CLIP-seq
MIRT1052096	hsa-miR-545	CLIP-seq
MIRT1052100	hsa-miR-548g	CLIP-seq
MIRT2011833	hsa-miR-549	CLIP-seq
MIRT2547131	hsa-miR-556-5p	CLIP-seq
MIRT1052103	hsa-miR-584	CLIP-seq
MIRT1051992	hsa-miR-590-5p	CLIP-seq
MIRT1052105	hsa-miR-606	CLIP-seq
MIRT1051993	hsa-miR-642b	CLIP-seq
MIRT2547132	hsa-miR-758	CLIP-seq
MIRT1052110	hsa-miR-876-5p	CLIP-seq
MIRT2547133	hsa-miR-924	CLIP-seq
MIRT1051998	hsa-miR-101	CLIP-seq
MIRT2011794	hsa-miR-1224-5p	CLIP-seq
MIRT2011795	hsa-miR-1243	CLIP-seq
MIRT1052007	hsa-miR-1290	CLIP-seq
MIRT1052014	hsa-miR-144	CLIP-seq
MIRT2011797	hsa-miR-155	CLIP-seq
MIRT1051947	hsa-miR-21	CLIP-seq
MIRT1052023	hsa-miR-298	CLIP-seq
MIRT1052028	hsa-miR-3148	CLIP-seq
MIRT1051955	hsa-miR-3160-5p	CLIP-seq
MIRT1052030	hsa-miR-3165	CLIP-seq
MIRT1052031	hsa-miR-3167	CLIP-seq
MIRT1052045	hsa-miR-3688-3p	CLIP-seq
MIRT2011812	hsa-miR-433	CLIP-seq
MIRT1052060	hsa-miR-4424	CLIP-seq
MIRT1052061	hsa-miR-4426	CLIP-seq
MIRT2547126	hsa-miR-4468	CLIP-seq
MIRT2011816	hsa-miR-4517	CLIP-seq
MIRT2011817	hsa-miR-4540	CLIP-seq
MIRT1052073	hsa-miR-4647	CLIP-seq
MIRT1052074	hsa-miR-4653-3p	CLIP-seq
MIRT1052076	hsa-miR-4662b	CLIP-seq
MIRT2011820	hsa-miR-4666-5p	CLIP-seq
MIRT1051971	hsa-miR-4694-3p	CLIP-seq
MIRT1052079	hsa-miR-4698	CLIP-seq
MIRT1052081	hsa-miR-4704-5p	CLIP-seq
MIRT2011825	hsa-miR-4751	CLIP-seq
MIRT2011826	hsa-miR-4760-3p	CLIP-seq
MIRT1052086	hsa-miR-4797-5p	CLIP-seq
MIRT2547129	hsa-miR-4799-5p	CLIP-seq
MIRT1051982	hsa-miR-517a	CLIP-seq
MIRT1051983	hsa-miR-517b	CLIP-seq
MIRT1051984	hsa-miR-517c	CLIP-seq
MIRT1052092	hsa-miR-520d-5p	CLIP-seq
MIRT1052093	hsa-miR-524-5p	CLIP-seq
MIRT1052100	hsa-miR-548g	CLIP-seq
MIRT2011833	hsa-miR-549	CLIP-seq
MIRT2547131	hsa-miR-556-5p	CLIP-seq
MIRT1051992	hsa-miR-590-5p	CLIP-seq
MIRT1052105	hsa-miR-606	CLIP-seq
MIRT1051993	hsa-miR-642b	CLIP-seq
MIRT1052110	hsa-miR-876-5p	CLIP-seq
MIRT2547133	hsa-miR-924	CLIP-seq
MIRT1051947	hsa-miR-21	CLIP-seq
MIRT1051992	hsa-miR-590-5p	CLIP-seq

148

Show/Hide all (148)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	9353307
GO:0000166	Function	Nucleotide binding	IEA
GO:0000228	Component	Nuclear chromosome	IDA	11003645
GO:0000380	Process	Alternative mRNA splicing, via spliceosome	IBA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IDA	22325991
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	21242313
GO:0000776	Component	Kinetochore	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000993	Function	RNA polymerase II complex binding	IDA	10490622
GO:0001097	Function	TFIIH-class transcription factor complex binding	IDA	10490622
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0003677	Function	DNA binding	IDA	9204873
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	1628625
GO:0003682	Function	Chromatin binding	IDA	9405365, 11909954, 28622508
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IDA	8068679, 8174554
GO:0003697	Function	Single-stranded DNA binding	IDA	1628625, 8068679, 8174554
GO:0003714	Function	Transcription corepressor activity	IMP	19617346, 23811339
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	23811339, 26244333, 28622508
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	IPI	18082603, 24463464
GO:0003723	Function	RNA binding	TAS	1628625
GO:0003725	Function	Double-stranded RNA binding	IDA	8174554
GO:0003727	Function	Single-stranded RNA binding	IDA	1628625, 8068679
GO:0003730	Function	MRNA 3'-UTR binding	IDA	17174306
GO:0003779	Function	Actin binding	IDA	15711563
GO:0005515	Function	Protein binding	IPI	7753047, 9105675, 9353307, 11909954, 17289661, 19174163, 19617346, 20858735, 21242313, 21988832, 22365833, 22720776, 24965446, 25616961, 25986610, 26030138, 26496610, 29721183, 30021884, 31694235, 32296183, 32814053, 33174841, 35271311
GO:0005524	Function	ATP binding	IDA	28622508
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9353307, 9405365, 11003645, 14608463, 19617346, 21242313, 22720776
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	28221134
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005697	Component	Telomerase holoenzyme complex	IDA	18082603
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	25986610
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA	19029303
GO:0005856	Component	Cytoskeleton	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006325	Process	Chromatin organization	TAS	24463464
GO:0006396	Process	RNA processing	IEA
GO:0006396	Process	RNA processing	TAS	1628625
GO:0006397	Process	MRNA processing	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	25986610
GO:0008143	Function	Poly(A) binding	IDA	8174554
GO:0008380	Process	RNA splicing	IEA
GO:0009048	Process	Dosage compensation by inactivation of X chromosome	IEA
GO:0009048	Process	Dosage compensation by inactivation of X chromosome	ISS
GO:0009986	Component	Cell surface	IDA	7993898
GO:0009986	Component	Cell surface	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0016071	Process	MRNA metabolic process	IEA
GO:0016363	Component	Nuclear matrix	IDA	8174554, 14608463
GO:0016363	Component	Nuclear matrix	IEA
GO:0016607	Component	Nuclear speck	IDA	9353307
GO:0016607	Component	Nuclear speck	IEA
GO:0017069	Function	SnRNA binding	IDA	22325991
GO:0017130	Function	Poly(C) RNA binding	IDA	8174554
GO:0030154	Process	Cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030496	Component	Midbody	IDA	25986610
GO:0030496	Component	Midbody	IEA
GO:0031048	Process	Regulatory ncRNA-mediated heterochromatin formation	IMP	25843628
GO:0031490	Function	Chromatin DNA binding	IDA	11003645
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IMP	18082603
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IDA	8174554, 9204873, 11909954, 19617346
GO:0033673	Process	Negative regulation of kinase activity	IMP	10490622
GO:0034046	Function	Poly(G) binding	IDA	8174554
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IMP	10490622
GO:0034584	Function	PiRNA binding	IPI	37332045
GO:0036002	Function	Pre-mRNA binding	IDA	22325991
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0042802	Function	Identical protein binding	IDA	28622508
GO:0043021	Function	Ribonucleoprotein complex binding	IDA	19617346
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	19617346
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	15711563
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048255	Process	MRNA stabilization	IDA	17174306
GO:0048511	Process	Rhythmic process	IEA
GO:0051301	Process	Cell division	IEA
GO:0051457	Process	Maintenance of protein location in nucleus	IMP	19617346
GO:0055013	Process	Cardiac muscle cell development	IEA
GO:0060816	Process	Random inactivation of X chromosome	IDA	25843628
GO:0060816	Process	Random inactivation of X chromosome	IEA
GO:0070034	Function	Telomerase RNA binding	IPI	18082603
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	19029303
GO:0070934	Process	CRD-mediated mRNA stabilization	IMP	19029303
GO:0070937	Component	CRD-mediated mRNA stability complex	IDA	19029303
GO:0070937	Component	CRD-mediated mRNA stability complex	IPI	19029303
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IDA	9353307
GO:0072686	Component	Mitotic spindle	IDA	21242313, 25986610
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	10490622
GO:0098577	Component	Inactive sex chromosome	IDA	14608463
GO:0098577	Component	Inactive sex chromosome	IEA
GO:0098963	Process	Dendritic transport of messenger ribonucleoprotein complex	IEA
GO:0099122	Function	RNA polymerase II C-terminal domain binding	IEA
GO:0099122	Function	RNA polymerase II C-terminal domain binding	ISS
GO:0106222	Function	LncRNA binding	IEA
GO:1900152	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	19029303
GO:1901673	Process	Regulation of mitotic spindle assembly	IMP	21242313
GO:1902275	Process	Regulation of chromatin organization	IMP	28622508
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	IMP	21242313
GO:1902889	Process	Protein localization to spindle microtubule	IMP	21242313
GO:1990023	Component	Mitotic spindle midzone	IDA	21242313
GO:1990280	Process	RNA localization to chromatin	IEA
GO:1990280	Process	RNA localization to chromatin	ISS
GO:1990498	Component	Mitotic spindle microtubule	IDA	21242313
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	9405365, 11003645
GO:1990841	Function	Promoter-specific chromatin binding	IBA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:1990841	Function	Promoter-specific chromatin binding	ISS
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:1990845	Process	Adaptive thermogenesis	ISS
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IDA	9405365, 11909954, 17289661, 19617346
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:2000373	Process	Positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity	ISS
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	ISS
GO:2000737	Process	Negative regulation of stem cell differentiation	IEA
GO:2000737	Process	Negative regulation of stem cell differentiation	IMP	21235343
GO:2000737	Process	Negative regulation of stem cell differentiation	ISS
GO:2000767	Process	Positive regulation of cytoplasmic translation	IDA	19029303

MIM	HGNC	e!Ensembl
602869	5048	ENSG00000153187

Q00839

Protein name

Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120)

Protein function

DNA- and RNA-binding protein involved in several cellular processes such as nuclear chromatin organization, telomere-length regulation, transcription, mRNA alternative splicing and stability, Xist-mediated transcriptional silencing and mitotic c

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02037	SAP	8 → 42	SAP domain	Family
PF00622	SPRY	333 → 462	SPRY domain	Family
PF13671	AAA_33	499 → 643		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:7509195}.

Sequence

MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSL
DLGGDSAGRSGAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGP
MEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAA
KEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGKKKAEGGGGGGRPGAPAAGDGKTEQKGG
DKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK
ISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVR
IGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELS
YAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVP
LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVA
GFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQ
RKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKE
EAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFR
GGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRG
NYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY

Sequence length

825

Interactions

View interactions

	KEGG		Reactome
	Spliceosome		mRNA Splicing - Major Pathway Processing of Capped Intron-Containing Pre-mRNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Developmental and epileptic encephalopathy, 1	Pathogenic	rs1057524584	RCV001824767	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Developmental and epileptic encephalopathy, 54	Pathogenic; Likely pathogenic	rs2102986749, rs2102990974, rs2102985115, rs2102987183, rs112081356, rs2102984978, rs2102985018, rs2102987155, rs779453109, rs2102987471, rs2102989374, rs2102987091, rs2102987181, rs2102985889, rs1680930166 View all (69 more)	RCV001374422 RCV001374423 RCV003104057 RCV002550245 RCV002550961 View all (80 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Epileptic encephalopathy	Pathogenic	rs1135401734, rs1135401733, rs1135401732	RCV000496120 RCV000496151 RCV000496124	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
heterogeneous nuclear ribonucleoprotein G, human	Pathogenic	rs2102990539, rs1553283895	RCV001387637 RCV000639401	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HNRNPU-related disorder	Pathogenic	rs886041983, rs1553282723	RCV005416271 RCV004545789	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Pathogenic; Likely pathogenic	rs2102985883, rs1135401733, rs1553283831, rs1680653195	RCV001526520 RCV000680009 RCV000505258 RCV001260726	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability and seizures	Likely pathogenic; Pathogenic	rs794729648	RCV000185558	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Pathogenic	rs2102990567	RCV002274345	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs2527880646	RCV004018279	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Seizure	Pathogenic	rs1135401733, rs2527890446	RCV000680009 RCV003384294	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
1Q44 MICRODELETION SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complex neurodevelopmental disorder	Conflicting classifications of pathogenicity	ClinVar ClinGen, GenCC	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY 54	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HNRNPU-related developmental and epileptic encephalopathy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic absence seizure	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (112)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
1q44 microdeletion syndrome	1q44 microdeletion syndrome	ORPHANET_DG	28283832		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
1q44 microdeletion syndrome	1q44 microdeletion syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute encephalopathy with biphasic seizures and late reduced diffusion	Encephalopathy With Biphasic Seizures And Diffusion	BEFREE	29858110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	9815576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29134320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29671412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29403425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29403425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31352174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33168013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31352174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33299500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28714951	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28714951, 29307321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	37815090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	29942082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	32915499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20550696, 20595387, 28779344, 7829252, 8443798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33495416, 36835467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
CAPILLARY MALFORMATION-ARTERIOVENOUS MALFORMATION (disorder)	Capillary Malformation-Arteriovenous Malformation	BEFREE	28530642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	9815576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29671412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37332045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31352174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28969027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	24634123, 28944577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of the kidney	Multicystic renal dysplasia	BEFREE	28393272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital malrotation of intestine	Congenital malrotation of intestine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cytochrome-c Oxidase Deficiency	Cytochrome-C Oxidase Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	28714951, 28944577, 33004838, 37120726, 37407733, 37815090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	23347178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	23347178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	20382278, 20795951, 21800092, 22678713, 23708187, 23934111, 25356899, 25533962, 25590979, 26845106, 28393272, 28815871, 28944577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28283832, 28393272, 29858110		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	28283832, 37120726, 37815090	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	CTD_human_DG	29942082		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	29942082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	GENOMICS_ENGLAND_DG	23708187, 23934111		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Epileptic encephalopathy	Epileptic encephalopathy	CLINVAR_DG	28815871		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Epileptic encephalopathy	Epileptic encephalopathy	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	37120726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 54	Epileptic encephalopathy	GENOMICS_ENGLAND_DG	23708187, 27652284		★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 54	Epileptic encephalopathy	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 54	Epileptic encephalopathy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31469911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31440166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31440166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10024672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	20382278, 29858110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Heart Septal Defects	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Horseshoe Kidney	Horseshoe Kidney	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	32653137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	BEFREE	28283832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of optic disc	Hypoplasia Of Optic Disc	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	24885232, 29858110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	22678713, 28283832, 28393272, 28944577		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	27652284		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	28283832, 28944577, 37120726, 37815090	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28779344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10365117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31331910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20595387, 28779344, 8443798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31331910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	9815576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12492499, 23950111, 28969027, 8287366, 8443798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28969027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	22678713, 28283832, 28393272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28058729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36444596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	20550696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31698570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31270100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	31270100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11889215, 12492499, 12671892, 14610055, 23950111, 8287366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32216806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28714951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	29942082		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	18560202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Radial polydactyly	Radial Polydactyly	BEFREE	24214579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	22678713, 28944577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	28393272, 29858110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spasms Infantile	Infantile spasms	Pubtator	24885232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	BEFREE	28393272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	9815576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36444596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29228625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35794744	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37923250, 37993881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Synophrys	Synophrys	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36347834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35130920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34309414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	24885232, 29858110		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked infantile spasms	Spasms X-Linked	BEFREE	28815871		★★★★★ ★☆☆☆☆ Found in Text Mining only

HNRNPU (heterogeneous nuclear ribonucleoprotein U)