Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3190
Gene name	Heterogeneous nuclear ribonucleoprotein K
Gene symbol	HNRNPK
Synonyms (NCBI Gene)	AUKSCSBPHNRPKTUNP
Chromosome	9
Chromosome location	9q21.32
Summary	This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in th

Show/Hide all (15)

SNP ID	Visualize variation	Clinical significance	Consequence
rs863223402	->C	Pathogenic	Coding sequence variant, splice donor variant
rs863223403	C>T	Pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs879255263	->AA	Pathogenic	Coding sequence variant, frameshift variant
rs886041807	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1064794967	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1085307831	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554698878	G>A	Pathogenic, likely-pathogenic	Coding sequence variant, stop gained
rs1554699378	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1554700678	C>T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1554700718	T>C	Likely-pathogenic	Intron variant
rs1564062144	C>T	Likely-pathogenic	Splice acceptor variant
rs1564063967	A>G	Pathogenic	Coding sequence variant, missense variant
rs1588417800	A>G	Pathogenic	Coding sequence variant, missense variant
rs1588432187	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1588434457	AGAA>TGAT	Likely-pathogenic	Coding sequence variant, missense variant

432

Show/Hide all (432)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004345	hsa-miR-450a-5p	Western blotMicroarray	18230805
MIRT005325	hsa-miR-21-5p	Luciferase reporter assayqRT-PCR	18829576
MIRT047832	hsa-miR-30c-5p	CLASH	23622248
MIRT047832	hsa-miR-30c-5p	CLASH	23622248
MIRT046389	hsa-miR-15b-5p	CLASH	23622248
MIRT046352	hsa-miR-23b-3p	CLASH	23622248
MIRT045940	hsa-miR-125b-5p	CLASH	23622248
MIRT043787	hsa-miR-328-3p	CLASH	23622248
MIRT042152	hsa-miR-484	CLASH	23622248
MIRT041102	hsa-miR-503-5p	CLASH	23622248
MIRT040216	hsa-miR-615-3p	CLASH	23622248
MIRT040216	hsa-miR-615-3p	CLASH	23622248
MIRT040216	hsa-miR-615-3p	CLASH	23622248
MIRT038583	hsa-miR-106b-3p	CLASH	23622248
MIRT037186	hsa-miR-877-3p	CLASH	23622248
MIRT052770	hsa-miR-1260b	CLASH	23622248
MIRT657332	hsa-miR-649	HITS-CLIP	23824327
MIRT657331	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT657330	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT657329	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT379535	hsa-miR-6511a-3p	HITS-CLIP	23824327
MIRT379536	hsa-miR-6511b-3p	HITS-CLIP	23824327
MIRT379537	hsa-miR-6784-3p	HITS-CLIP	23824327
MIRT379538	hsa-miR-6862-3p	HITS-CLIP	23824327
MIRT379534	hsa-miR-1229-3p	HITS-CLIP	23824327
MIRT734547	hsa-miR-148a-3p	Immunoprecipitaion (IP)In situ hybridizationMicroarrayWestern blotting	33931969
MIRT657332	hsa-miR-649	HITS-CLIP	23824327
MIRT657331	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT657330	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT657329	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT379535	hsa-miR-6511a-3p	HITS-CLIP	23824327
MIRT379536	hsa-miR-6511b-3p	HITS-CLIP	23824327
MIRT379537	hsa-miR-6784-3p	HITS-CLIP	23824327
MIRT379538	hsa-miR-6862-3p	HITS-CLIP	23824327
MIRT379534	hsa-miR-1229-3p	HITS-CLIP	23824327
MIRT1051728	hsa-miR-1	CLIP-seq
MIRT1051729	hsa-miR-105	CLIP-seq
MIRT1051730	hsa-miR-1224-3p	CLIP-seq
MIRT1051731	hsa-miR-1249	CLIP-seq
MIRT1051732	hsa-miR-1264	CLIP-seq
MIRT1051733	hsa-miR-1275	CLIP-seq
MIRT1051734	hsa-miR-1276	CLIP-seq
MIRT1051735	hsa-miR-1278	CLIP-seq
MIRT1051736	hsa-miR-1286	CLIP-seq
MIRT1051737	hsa-miR-129-5p	CLIP-seq
MIRT1051738	hsa-miR-181a	CLIP-seq
MIRT1051739	hsa-miR-181b	CLIP-seq
MIRT1051740	hsa-miR-181c	CLIP-seq
MIRT1051741	hsa-miR-181d	CLIP-seq
MIRT1051742	hsa-miR-205	CLIP-seq
MIRT1051743	hsa-miR-206	CLIP-seq
MIRT1051744	hsa-miR-219-2-3p	CLIP-seq
MIRT1051745	hsa-miR-2278	CLIP-seq
MIRT1051746	hsa-miR-2467-3p	CLIP-seq
MIRT1051747	hsa-miR-2681	CLIP-seq
MIRT1051748	hsa-miR-28-5p	CLIP-seq
MIRT1051749	hsa-miR-2964a-3p	CLIP-seq
MIRT1051750	hsa-miR-298	CLIP-seq
MIRT1051751	hsa-miR-3117-5p	CLIP-seq
MIRT1051752	hsa-miR-3119	CLIP-seq
MIRT1051753	hsa-miR-3120-3p	CLIP-seq
MIRT1051754	hsa-miR-3125	CLIP-seq
MIRT1051755	hsa-miR-3129-3p	CLIP-seq
MIRT1051756	hsa-miR-3130-3p	CLIP-seq
MIRT1051757	hsa-miR-3139	CLIP-seq
MIRT1051758	hsa-miR-3157-5p	CLIP-seq
MIRT1051759	hsa-miR-3160-3p	CLIP-seq
MIRT1051760	hsa-miR-3168	CLIP-seq
MIRT1051761	hsa-miR-3194-3p	CLIP-seq
MIRT1051762	hsa-miR-3591-5p	CLIP-seq
MIRT1051763	hsa-miR-3617	CLIP-seq
MIRT1051764	hsa-miR-3647-3p	CLIP-seq
MIRT1051765	hsa-miR-3662	CLIP-seq
MIRT1051766	hsa-miR-3671	CLIP-seq
MIRT1051767	hsa-miR-3679-3p	CLIP-seq
MIRT1051768	hsa-miR-3680	CLIP-seq
MIRT1051769	hsa-miR-3685	CLIP-seq
MIRT1051770	hsa-miR-376c	CLIP-seq
MIRT1051771	hsa-miR-384	CLIP-seq
MIRT1051772	hsa-miR-3916	CLIP-seq
MIRT1051773	hsa-miR-3919	CLIP-seq
MIRT1051774	hsa-miR-3934	CLIP-seq
MIRT1051775	hsa-miR-3940-5p	CLIP-seq
MIRT1051776	hsa-miR-409-3p	CLIP-seq
MIRT1051777	hsa-miR-412	CLIP-seq
MIRT1051778	hsa-miR-4255	CLIP-seq
MIRT1051779	hsa-miR-4260	CLIP-seq
MIRT1051780	hsa-miR-4262	CLIP-seq
MIRT1051781	hsa-miR-4277	CLIP-seq
MIRT1051782	hsa-miR-4282	CLIP-seq
MIRT1051783	hsa-miR-4286	CLIP-seq
MIRT1051784	hsa-miR-4291	CLIP-seq
MIRT1051785	hsa-miR-4310	CLIP-seq
MIRT1051786	hsa-miR-4325	CLIP-seq
MIRT1051787	hsa-miR-4452	CLIP-seq
MIRT1051788	hsa-miR-4455	CLIP-seq
MIRT1051789	hsa-miR-4480	CLIP-seq
MIRT1051790	hsa-miR-4491	CLIP-seq
MIRT1051791	hsa-miR-4507	CLIP-seq
MIRT1051792	hsa-miR-450b-5p	CLIP-seq
MIRT1051793	hsa-miR-4539	CLIP-seq
MIRT1051794	hsa-miR-4639-3p	CLIP-seq
MIRT1051795	hsa-miR-4645-3p	CLIP-seq
MIRT1051796	hsa-miR-4651	CLIP-seq
MIRT1051797	hsa-miR-4657	CLIP-seq
MIRT1051798	hsa-miR-4665-5p	CLIP-seq
MIRT1051799	hsa-miR-4666-5p	CLIP-seq
MIRT1051800	hsa-miR-4691-3p	CLIP-seq
MIRT1051801	hsa-miR-4698	CLIP-seq
MIRT1051802	hsa-miR-4704-5p	CLIP-seq
MIRT1051803	hsa-miR-4705	CLIP-seq
MIRT1051804	hsa-miR-4708-5p	CLIP-seq
MIRT1051805	hsa-miR-4722-5p	CLIP-seq
MIRT1051806	hsa-miR-4731-3p	CLIP-seq
MIRT1051807	hsa-miR-4755-3p	CLIP-seq
MIRT1051808	hsa-miR-4762-5p	CLIP-seq
MIRT1051809	hsa-miR-4781-3p	CLIP-seq
MIRT1051810	hsa-miR-4793-3p	CLIP-seq
MIRT1051811	hsa-miR-4796-5p	CLIP-seq
MIRT1051812	hsa-miR-4801	CLIP-seq
MIRT1051813	hsa-miR-4802-3p	CLIP-seq
MIRT1051814	hsa-miR-4803	CLIP-seq
MIRT1051815	hsa-miR-507	CLIP-seq
MIRT1051816	hsa-miR-5095	CLIP-seq
MIRT1051817	hsa-miR-513a-3p	CLIP-seq
MIRT1051818	hsa-miR-513b	CLIP-seq
MIRT1051819	hsa-miR-520d-5p	CLIP-seq
MIRT1051820	hsa-miR-522	CLIP-seq
MIRT1051821	hsa-miR-524-5p	CLIP-seq
MIRT1051822	hsa-miR-539	CLIP-seq
MIRT1051823	hsa-miR-544	CLIP-seq
MIRT1051824	hsa-miR-545	CLIP-seq
MIRT1051825	hsa-miR-548c-3p	CLIP-seq
MIRT1051826	hsa-miR-552	CLIP-seq
MIRT1051827	hsa-miR-557	CLIP-seq
MIRT1051828	hsa-miR-577	CLIP-seq
MIRT1051829	hsa-miR-600	CLIP-seq
MIRT1051830	hsa-miR-607	CLIP-seq
MIRT1051831	hsa-miR-608	CLIP-seq
MIRT1051832	hsa-miR-609	CLIP-seq
MIRT1051833	hsa-miR-613	CLIP-seq
MIRT1051834	hsa-miR-625	CLIP-seq
MIRT1051835	hsa-miR-641	CLIP-seq
MIRT1051836	hsa-miR-708	CLIP-seq
MIRT1051837	hsa-miR-873	CLIP-seq
MIRT1051838	hsa-miR-943	CLIP-seq
MIRT1051728	hsa-miR-1	CLIP-seq
MIRT1051729	hsa-miR-105	CLIP-seq
MIRT2011765	hsa-miR-10a	CLIP-seq
MIRT2011766	hsa-miR-10b	CLIP-seq
MIRT1051731	hsa-miR-1249	CLIP-seq
MIRT1051737	hsa-miR-129-5p	CLIP-seq
MIRT2011767	hsa-miR-1305	CLIP-seq
MIRT1051738	hsa-miR-181a	CLIP-seq
MIRT1051739	hsa-miR-181b	CLIP-seq
MIRT1051740	hsa-miR-181c	CLIP-seq
MIRT1051741	hsa-miR-181d	CLIP-seq
MIRT1051743	hsa-miR-206	CLIP-seq
MIRT1051746	hsa-miR-2467-3p	CLIP-seq
MIRT1051748	hsa-miR-28-5p	CLIP-seq
MIRT1051750	hsa-miR-298	CLIP-seq
MIRT2011768	hsa-miR-3065-5p	CLIP-seq
MIRT1051752	hsa-miR-3119	CLIP-seq
MIRT1051754	hsa-miR-3125	CLIP-seq
MIRT1051756	hsa-miR-3130-3p	CLIP-seq
MIRT2011769	hsa-miR-3138	CLIP-seq
MIRT1051757	hsa-miR-3139	CLIP-seq
MIRT2011770	hsa-miR-3152-5p	CLIP-seq
MIRT1051759	hsa-miR-3160-3p	CLIP-seq
MIRT1051760	hsa-miR-3168	CLIP-seq
MIRT1051761	hsa-miR-3194-3p	CLIP-seq
MIRT2011771	hsa-miR-323-3p	CLIP-seq
MIRT1051764	hsa-miR-3647-3p	CLIP-seq
MIRT2011772	hsa-miR-3658	CLIP-seq
MIRT1051766	hsa-miR-3671	CLIP-seq
MIRT1051767	hsa-miR-3679-3p	CLIP-seq
MIRT1051772	hsa-miR-3916	CLIP-seq
MIRT2011773	hsa-miR-3920	CLIP-seq
MIRT2011774	hsa-miR-3928	CLIP-seq
MIRT1051774	hsa-miR-3934	CLIP-seq
MIRT1051776	hsa-miR-409-3p	CLIP-seq
MIRT1051777	hsa-miR-412	CLIP-seq
MIRT2011775	hsa-miR-421	CLIP-seq
MIRT1051780	hsa-miR-4262	CLIP-seq
MIRT1051782	hsa-miR-4282	CLIP-seq
MIRT2011776	hsa-miR-4299	CLIP-seq
MIRT1051786	hsa-miR-4325	CLIP-seq
MIRT2011777	hsa-miR-4456	CLIP-seq
MIRT1051789	hsa-miR-4480	CLIP-seq
MIRT2011778	hsa-miR-4490	CLIP-seq
MIRT1051790	hsa-miR-4491	CLIP-seq
MIRT1051792	hsa-miR-450b-5p	CLIP-seq
MIRT1051793	hsa-miR-4539	CLIP-seq
MIRT1051794	hsa-miR-4639-3p	CLIP-seq
MIRT1051797	hsa-miR-4657	CLIP-seq
MIRT2011779	hsa-miR-4668-3p	CLIP-seq
MIRT1051801	hsa-miR-4698	CLIP-seq
MIRT1051803	hsa-miR-4705	CLIP-seq
MIRT1051804	hsa-miR-4708-5p	CLIP-seq
MIRT1051807	hsa-miR-4755-3p	CLIP-seq
MIRT2011780	hsa-miR-4762-3p	CLIP-seq
MIRT1051808	hsa-miR-4762-5p	CLIP-seq
MIRT2011781	hsa-miR-4774-3p	CLIP-seq
MIRT2011782	hsa-miR-4774-5p	CLIP-seq
MIRT2011783	hsa-miR-4778-5p	CLIP-seq
MIRT1051809	hsa-miR-4781-3p	CLIP-seq
MIRT1051810	hsa-miR-4793-3p	CLIP-seq
MIRT2011784	hsa-miR-4800-5p	CLIP-seq
MIRT1051815	hsa-miR-507	CLIP-seq
MIRT1051816	hsa-miR-5095	CLIP-seq
MIRT1051817	hsa-miR-513a-3p	CLIP-seq
MIRT1051818	hsa-miR-513b	CLIP-seq
MIRT1051819	hsa-miR-520d-5p	CLIP-seq
MIRT1051821	hsa-miR-524-5p	CLIP-seq
MIRT1051822	hsa-miR-539	CLIP-seq
MIRT1051823	hsa-miR-544	CLIP-seq
MIRT2011785	hsa-miR-548a-3p	CLIP-seq
MIRT2011786	hsa-miR-548e	CLIP-seq
MIRT2011787	hsa-miR-548f	CLIP-seq
MIRT2011788	hsa-miR-548q	CLIP-seq
MIRT1051826	hsa-miR-552	CLIP-seq
MIRT1051827	hsa-miR-557	CLIP-seq
MIRT1051830	hsa-miR-607	CLIP-seq
MIRT1051833	hsa-miR-613	CLIP-seq
MIRT1051836	hsa-miR-708	CLIP-seq
MIRT1051728	hsa-miR-1	CLIP-seq
MIRT1051729	hsa-miR-105	CLIP-seq
MIRT2011765	hsa-miR-10a	CLIP-seq
MIRT2011766	hsa-miR-10b	CLIP-seq
MIRT1051730	hsa-miR-1224-3p	CLIP-seq
MIRT2244039	hsa-miR-1238	CLIP-seq
MIRT1051731	hsa-miR-1249	CLIP-seq
MIRT2244040	hsa-miR-1260	CLIP-seq
MIRT1051732	hsa-miR-1264	CLIP-seq
MIRT1051734	hsa-miR-1276	CLIP-seq
MIRT2244041	hsa-miR-1280	CLIP-seq
MIRT1051737	hsa-miR-129-5p	CLIP-seq
MIRT1051738	hsa-miR-181a	CLIP-seq
MIRT1051739	hsa-miR-181b	CLIP-seq
MIRT1051740	hsa-miR-181c	CLIP-seq
MIRT1051741	hsa-miR-181d	CLIP-seq
MIRT1051743	hsa-miR-206	CLIP-seq
MIRT1051745	hsa-miR-2278	CLIP-seq
MIRT1051746	hsa-miR-2467-3p	CLIP-seq
MIRT1051750	hsa-miR-298	CLIP-seq
MIRT1051752	hsa-miR-3119	CLIP-seq
MIRT1051754	hsa-miR-3125	CLIP-seq
MIRT1051756	hsa-miR-3130-3p	CLIP-seq
MIRT2011769	hsa-miR-3138	CLIP-seq
MIRT2011770	hsa-miR-3152-5p	CLIP-seq
MIRT1051761	hsa-miR-3194-3p	CLIP-seq
MIRT2011771	hsa-miR-323-3p	CLIP-seq
MIRT2244042	hsa-miR-330-3p	CLIP-seq
MIRT2244043	hsa-miR-339-5p	CLIP-seq
MIRT1051767	hsa-miR-3679-3p	CLIP-seq
MIRT1051769	hsa-miR-3685	CLIP-seq
MIRT1051771	hsa-miR-384	CLIP-seq
MIRT1051772	hsa-miR-3916	CLIP-seq
MIRT1051773	hsa-miR-3919	CLIP-seq
MIRT2244044	hsa-miR-3924	CLIP-seq
MIRT1051776	hsa-miR-409-3p	CLIP-seq
MIRT1051780	hsa-miR-4262	CLIP-seq
MIRT1051782	hsa-miR-4282	CLIP-seq
MIRT1051786	hsa-miR-4325	CLIP-seq
MIRT1051789	hsa-miR-4480	CLIP-seq
MIRT2011778	hsa-miR-4490	CLIP-seq
MIRT1051790	hsa-miR-4491	CLIP-seq
MIRT1051792	hsa-miR-450b-5p	CLIP-seq
MIRT1051793	hsa-miR-4539	CLIP-seq
MIRT1051795	hsa-miR-4645-3p	CLIP-seq
MIRT1051797	hsa-miR-4657	CLIP-seq
MIRT2244045	hsa-miR-4691-5p	CLIP-seq
MIRT1051801	hsa-miR-4698	CLIP-seq
MIRT1051803	hsa-miR-4705	CLIP-seq
MIRT1051804	hsa-miR-4708-5p	CLIP-seq
MIRT1051806	hsa-miR-4731-3p	CLIP-seq
MIRT1051807	hsa-miR-4755-3p	CLIP-seq
MIRT2244046	hsa-miR-4761-5p	CLIP-seq
MIRT2011781	hsa-miR-4774-3p	CLIP-seq
MIRT2011782	hsa-miR-4774-5p	CLIP-seq
MIRT1051809	hsa-miR-4781-3p	CLIP-seq
MIRT1051810	hsa-miR-4793-3p	CLIP-seq
MIRT1051811	hsa-miR-4796-5p	CLIP-seq
MIRT2011784	hsa-miR-4800-5p	CLIP-seq
MIRT1051812	hsa-miR-4801	CLIP-seq
MIRT1051815	hsa-miR-507	CLIP-seq
MIRT1051817	hsa-miR-513a-3p	CLIP-seq
MIRT1051820	hsa-miR-522	CLIP-seq
MIRT1051822	hsa-miR-539	CLIP-seq
MIRT1051823	hsa-miR-544	CLIP-seq
MIRT1051827	hsa-miR-557	CLIP-seq
MIRT2244047	hsa-miR-582-5p	CLIP-seq
MIRT1051830	hsa-miR-607	CLIP-seq
MIRT1051833	hsa-miR-613	CLIP-seq
MIRT2011765	hsa-miR-10a	CLIP-seq
MIRT2011766	hsa-miR-10b	CLIP-seq
MIRT2389092	hsa-miR-3163	CLIP-seq
MIRT1051822	hsa-miR-539	CLIP-seq
MIRT1051732	hsa-miR-1264	CLIP-seq
MIRT1051735	hsa-miR-1278	CLIP-seq
MIRT1051795	hsa-miR-4645-3p	CLIP-seq
MIRT1051811	hsa-miR-4796-5p	CLIP-seq
MIRT1051822	hsa-miR-539	CLIP-seq
MIRT2429683	hsa-miR-885-5p	CLIP-seq
MIRT2429684	hsa-miR-888	CLIP-seq
MIRT2011765	hsa-miR-10a	CLIP-seq
MIRT2011766	hsa-miR-10b	CLIP-seq
MIRT1051730	hsa-miR-1224-3p	CLIP-seq
MIRT2547069	hsa-miR-1226	CLIP-seq
MIRT2244039	hsa-miR-1238	CLIP-seq
MIRT1051731	hsa-miR-1249	CLIP-seq
MIRT2244040	hsa-miR-1260	CLIP-seq
MIRT2547070	hsa-miR-1272	CLIP-seq
MIRT2244041	hsa-miR-1280	CLIP-seq
MIRT1051737	hsa-miR-129-5p	CLIP-seq
MIRT2547071	hsa-miR-1322	CLIP-seq
MIRT2547072	hsa-miR-21	CLIP-seq
MIRT2547073	hsa-miR-2355-5p	CLIP-seq
MIRT2547074	hsa-miR-3134	CLIP-seq
MIRT2011770	hsa-miR-3152-5p	CLIP-seq
MIRT2389092	hsa-miR-3163	CLIP-seq
MIRT2011771	hsa-miR-323-3p	CLIP-seq
MIRT2244042	hsa-miR-330-3p	CLIP-seq
MIRT2244043	hsa-miR-339-5p	CLIP-seq
MIRT2547075	hsa-miR-3613-3p	CLIP-seq
MIRT1051767	hsa-miR-3679-3p	CLIP-seq
MIRT2244044	hsa-miR-3924	CLIP-seq
MIRT2547076	hsa-miR-3942-5p	CLIP-seq
MIRT1051782	hsa-miR-4282	CLIP-seq
MIRT1051789	hsa-miR-4480	CLIP-seq
MIRT1051792	hsa-miR-450b-5p	CLIP-seq
MIRT2547077	hsa-miR-4534	CLIP-seq
MIRT2547078	hsa-miR-4659a-3p	CLIP-seq
MIRT2547079	hsa-miR-4659b-3p	CLIP-seq
MIRT1051799	hsa-miR-4666-5p	CLIP-seq
MIRT2011779	hsa-miR-4668-3p	CLIP-seq
MIRT2547080	hsa-miR-4688	CLIP-seq
MIRT2244045	hsa-miR-4691-5p	CLIP-seq
MIRT1051801	hsa-miR-4698	CLIP-seq
MIRT2547081	hsa-miR-4703-5p	CLIP-seq
MIRT2547082	hsa-miR-4733-3p	CLIP-seq
MIRT2244046	hsa-miR-4761-5p	CLIP-seq
MIRT2011781	hsa-miR-4774-3p	CLIP-seq
MIRT2547083	hsa-miR-4776-3p	CLIP-seq
MIRT2547084	hsa-miR-4795-3p	CLIP-seq
MIRT1051813	hsa-miR-4802-3p	CLIP-seq
MIRT2547085	hsa-miR-495	CLIP-seq
MIRT1051815	hsa-miR-507	CLIP-seq
MIRT1051817	hsa-miR-513a-3p	CLIP-seq
MIRT1051818	hsa-miR-513b	CLIP-seq
MIRT2547086	hsa-miR-518a-5p	CLIP-seq
MIRT2547087	hsa-miR-527	CLIP-seq
MIRT1051825	hsa-miR-548c-3p	CLIP-seq
MIRT2547088	hsa-miR-548n	CLIP-seq
MIRT1051827	hsa-miR-557	CLIP-seq
MIRT2244047	hsa-miR-582-5p	CLIP-seq
MIRT2547089	hsa-miR-590-5p	CLIP-seq
MIRT2547090	hsa-miR-605	CLIP-seq
MIRT1051830	hsa-miR-607	CLIP-seq
MIRT2547091	hsa-miR-617	CLIP-seq
MIRT1051834	hsa-miR-625	CLIP-seq
MIRT2547092	hsa-miR-653	CLIP-seq
MIRT2011765	hsa-miR-10a	CLIP-seq
MIRT2011766	hsa-miR-10b	CLIP-seq
MIRT1051730	hsa-miR-1224-3p	CLIP-seq
MIRT2547069	hsa-miR-1226	CLIP-seq
MIRT2244039	hsa-miR-1238	CLIP-seq
MIRT1051731	hsa-miR-1249	CLIP-seq
MIRT2244040	hsa-miR-1260	CLIP-seq
MIRT2547070	hsa-miR-1272	CLIP-seq
MIRT1051735	hsa-miR-1278	CLIP-seq
MIRT2244041	hsa-miR-1280	CLIP-seq
MIRT1051737	hsa-miR-129-5p	CLIP-seq
MIRT2547071	hsa-miR-1322	CLIP-seq
MIRT2547072	hsa-miR-21	CLIP-seq
MIRT2547073	hsa-miR-2355-5p	CLIP-seq
MIRT2547074	hsa-miR-3134	CLIP-seq
MIRT2011769	hsa-miR-3138	CLIP-seq
MIRT1051760	hsa-miR-3168	CLIP-seq
MIRT2011771	hsa-miR-323-3p	CLIP-seq
MIRT2244042	hsa-miR-330-3p	CLIP-seq
MIRT2244043	hsa-miR-339-5p	CLIP-seq
MIRT2547075	hsa-miR-3613-3p	CLIP-seq
MIRT1051764	hsa-miR-3647-3p	CLIP-seq
MIRT1051767	hsa-miR-3679-3p	CLIP-seq
MIRT1051770	hsa-miR-376c	CLIP-seq
MIRT2244044	hsa-miR-3924	CLIP-seq
MIRT2547076	hsa-miR-3942-5p	CLIP-seq
MIRT1051777	hsa-miR-412	CLIP-seq
MIRT1051782	hsa-miR-4282	CLIP-seq
MIRT1051783	hsa-miR-4286	CLIP-seq
MIRT1051789	hsa-miR-4480	CLIP-seq
MIRT2011778	hsa-miR-4490	CLIP-seq
MIRT1051790	hsa-miR-4491	CLIP-seq
MIRT1051792	hsa-miR-450b-5p	CLIP-seq
MIRT2547077	hsa-miR-4534	CLIP-seq
MIRT1051797	hsa-miR-4657	CLIP-seq
MIRT2547078	hsa-miR-4659a-3p	CLIP-seq
MIRT2547079	hsa-miR-4659b-3p	CLIP-seq
MIRT1051799	hsa-miR-4666-5p	CLIP-seq
MIRT2011779	hsa-miR-4668-3p	CLIP-seq
MIRT2547080	hsa-miR-4688	CLIP-seq
MIRT2244045	hsa-miR-4691-5p	CLIP-seq
MIRT1051801	hsa-miR-4698	CLIP-seq
MIRT2547081	hsa-miR-4703-5p	CLIP-seq
MIRT2547082	hsa-miR-4733-3p	CLIP-seq
MIRT1051807	hsa-miR-4755-3p	CLIP-seq
MIRT2244046	hsa-miR-4761-5p	CLIP-seq
MIRT2011782	hsa-miR-4774-5p	CLIP-seq
MIRT2547083	hsa-miR-4776-3p	CLIP-seq
MIRT2547084	hsa-miR-4795-3p	CLIP-seq
MIRT2011784	hsa-miR-4800-5p	CLIP-seq
MIRT1051813	hsa-miR-4802-3p	CLIP-seq
MIRT1051814	hsa-miR-4803	CLIP-seq
MIRT2547085	hsa-miR-495	CLIP-seq
MIRT1051815	hsa-miR-507	CLIP-seq
MIRT1051817	hsa-miR-513a-3p	CLIP-seq
MIRT1051818	hsa-miR-513b	CLIP-seq
MIRT2547086	hsa-miR-518a-5p	CLIP-seq
MIRT2547087	hsa-miR-527	CLIP-seq
MIRT1051825	hsa-miR-548c-3p	CLIP-seq
MIRT2547088	hsa-miR-548n	CLIP-seq
MIRT1051827	hsa-miR-557	CLIP-seq
MIRT2244047	hsa-miR-582-5p	CLIP-seq
MIRT2547089	hsa-miR-590-5p	CLIP-seq
MIRT2547090	hsa-miR-605	CLIP-seq
MIRT1051830	hsa-miR-607	CLIP-seq
MIRT2547091	hsa-miR-617	CLIP-seq
MIRT1051834	hsa-miR-625	CLIP-seq
MIRT2547092	hsa-miR-653	CLIP-seq
MIRT2429683	hsa-miR-885-5p	CLIP-seq
MIRT2429684	hsa-miR-888	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0000785	Component	Chromatin	IDA	20371611, 33174841
GO:0002102	Component	Podosome	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	8107114
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	9651361, 10332027, 10749975, 12183465, 12577067, 16189514, 16713569, 17178840, 18457437, 18775702, 19101556, 19174163, 19249676, 20085233, 20936779, 21044950, 21516116, 21821029, 21988832, 22365833, 23092970, 23825951, 24965446, 25416956, 25678563, 25910212, 26496610, 26871637, 2710
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	33174841
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	33174841
GO:0005737	Component	Cytoplasm	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006396	Process	RNA processing	TAS	8107114
GO:0006397	Process	MRNA processing	IEA
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0008380	Process	RNA splicing	IEA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019904	Function	Protein domain specific binding	IPI	10749975
GO:0031048	Process	Regulatory ncRNA-mediated heterochromatin formation	IMP	25843628
GO:0042802	Function	Identical protein binding	IPI	16004877, 16189514, 22365833, 25416956, 29892012, 32296183, 32499643
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	20548952
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	33174841
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048024	Process	Regulation of mRNA splicing, via spliceosome	IBA
GO:0048025	Process	Negative regulation of mRNA splicing, via spliceosome	IEA
GO:0051253	Process	Negative regulation of RNA metabolic process	IEA
GO:0060816	Process	Random inactivation of X chromosome	IDA	25843628
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:1902165	Process	Regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:1905581	Process	Positive regulation of low-density lipoprotein particle clearance	IMP	20371611
GO:1990904	Component	Ribonucleoprotein complex	IDA	33174841
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
600712	5044	ENSG00000165119

P61978

Protein name

Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP)

Protein function

One of the major pre-mRNA-binding proteins. Binds tenaciously to poly(C) sequences. Likely to play a role in the nuclear metabolism of hnRNAs, particularly for pre-mRNAs that contain cytidine-rich sequences. Can also bind poly(C) single-stranded

PDB

1J5K , 1KHM , 1ZZI , 1ZZJ , 1ZZK , 7CRE , 7CRU , 7RJK , 7RJO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08067	ROKNT	1 → 43	ROKNT (NUC014) domain	Domain
PF00013	KH_1	44 → 105	KH domain	Domain
PF00013	KH_1	146 → 211	KH domain	Domain
PF00013	KH_1	389 → 453	KH domain	Domain

Sequence

METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF

Sequence length

463

Interactions

View interactions

	KEGG		Reactome
	Spliceosome Viral carcinogenesis MicroRNAs in cancer		SUMOylation of RNA binding proteins mRNA Splicing - Major Pathway Processing of Capped Intron-Containing Pre-mRNA HCMV Late Events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Au-Kline syndrome	Likely pathogenic; Pathogenic	rs1956915416, rs1956917064, rs2133014993, rs2133042086, rs2133020093, rs1348162749, rs2133020130, rs2491980145, rs2491962567, rs2491962345, rs2491952548, rs2491985651, rs2492017096, rs863223402, rs863223403 View all (29 more)	RCV001330886 RCV001330885 RCV001391299 RCV001650471 RCV002249073 View all (39 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Generalized hypotonia	Likely pathogenic	rs2133039624	RCV001526568	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HNRNPK-related disorder	Likely pathogenic; Pathogenic	rs2491957229, rs2491980539, rs2491962274	RCV003403071 RCV003403072 RCV003404491	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Pathogenic	rs1956764279	RCV001261372	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neonatal encephalopathy	Likely pathogenic; Pathogenic	rs2491969421	RCV003154303	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER-CRANIOFACIAL DYSMORPHISM-CARDIAC DEFECT-HIP DYSPLASIA SYNDROME	—	CTD, ClinGen	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER-CRANIOFACIAL DYSMORPHISM-CARDIAC DEFECT-SKELETAL ANOMALIES SYNDROME DUE TO 9Q21.3 MICRODELETION	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER-CRANIOFACIAL DYSMORPHISM-CARDIAC DEFECT-SKELETAL ANOMALIES SYNDROME DUE TO A POINT MUTATION	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RAYNAUD DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (143)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31187136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25410660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36261283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28423622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
AU-KLINE SYNDROME	AU-KLINE Syndrome	GENOMICS_ENGLAND_DG	19477957, 26638989, 26954065, 28771707, 29904177		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AU-KLINE SYNDROME	AU-KLINE Syndrome	CLINVAR_DG	26173930, 26954065, 28374925, 28771707		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AU-KLINE SYNDROME	AU-KLINE Syndrome	ORPHANET_DG	26173930		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AU-KLINE SYNDROME	AU-KLINE Syndrome	BEFREE	30793470, 31538344		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AU-KLINE SYNDROME	AU-KLINE Syndrome	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31077320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral fetal pyelectasis	Bilateral Fetal Pyelectasis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27862976, 30397178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	16293596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachycephaly	Brachycephaly	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11121407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21466612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30468106, 33806648, 40604083	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	26317903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26317903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16953238, 19609950, 20499280, 25645922, 26713736, 27862976, 31187136, 35866661, 36209503, 36681772, 36700980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22760167, 31429522, 33891563, 34299096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27862976, 30397178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31492158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26713736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	31329361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30444036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26804170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16404425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28335083, 29410604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16953238	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30272263, 32901844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	28374925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30444036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital dermal melanocytosis	Congenital Dermal Melanocytosis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	26954065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26713736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24148886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	37407733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31501273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31501273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28324005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31178390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31077320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	10523673, 10817758, 10995551, 11574481, 11867641, 11891683, 12183465, 12853611, 15170860, 15284851, 15364910, 16488668, 18054780, 19170760, 19348700 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	20499280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37460467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26305187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26305187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26412324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	26412324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrichosis	HYPERTRICHOSIS	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	26173930	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	BEFREE	26954065		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	29904177		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Kabuki make-up syndrome	Kabuki Syndrome	BEFREE	28374925, 28771707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kabuki syndrome	Kabuki syndrome	Pubtator	26954065, 36130591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis Dendritic	Herpetic keratitis	Pubtator	36261283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27155326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25005557, 27155326, 30476680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23455382, 31148184, 31429522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	22760167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long narrow head	Dolichocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12871776, 31492158, 36681772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31077320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11121407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21466612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28315432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31492158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19609950, 20499280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18413735, 19258514, 19319982, 22815235, 31221168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29262567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27862976, 30397178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11121407, 19609950, 20499280, 23564449, 24508256, 25012652, 25713416, 26412324, 27424288, 28708135, 29262567, 29410604, 30836866, 31538344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21466612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21466612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21466612		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20499280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20499280, 26136337, 30272263, 32901844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	10523673, 10817758, 10995551, 11574481, 11867641, 11891683, 12183465, 12853611, 15170860, 15284851, 15364910, 16488668, 18054780, 19170760, 19348700 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular ventricular septum defect	Muscular ventricular septal defect	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	30144205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30249787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30249787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16293596, 19653139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19330019, 20224598, 24885469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24885469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck webbing	Neck Webbing	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal Hypotonia	Hypotonia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19258514, 19609950, 22582387, 23564449, 25713416, 26412324, 26713736, 26804170, 27424288, 28315432, 28869607, 29262567, 29410604, 30144205, 31077320, 31127648, 31492158, 31538344 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27292014, 29311158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental disorder-craniofacial dysmorphism-cardiac defect-skeletal anomalies syndrome due to 9q21.3 microdeletion	Neurodevelopmental Disorder-Craniofacial Dysmorphism-Cardiac Defect-Skeletal Anomalies Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder-craniofacial dysmorphism-cardiac defect-skeletal anomalies syndrome due to a point mutation	Neurodevelopmental Disorder-Craniofacial Dysmorphism-Cardiac Defect-Skeletal Anomalies Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31187136, 31492158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodontia	Oligodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24148886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34575922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19609950, 20499280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19609950	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20499280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular nodular heterotopia	Pubtator	26954065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	GENOMICS_ENGLAND_DG	19477957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	BEFREE	28374925		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYDACTYLY, POSTAXIAL	Polydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	31395945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18413735, 19258514, 19319982, 22815235, 31221168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19258514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19401687, 29966326, 31221168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26713736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sagittal craniosynostosis	Sagittal craniosynostosis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	25713416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 10	Spinocerebellar ataxia	Pubtator	20548952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17667925, 19015635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19015635, 32901844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24508256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29262567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Supernumerary mesiodens tooth	Supernumerary Mesiodens Tooth	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31110205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37592256, 38238853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27862976, 29480994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35866661, 36700980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

HNRNPK (heterogeneous nuclear ribonucleoprotein K)