Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3187
Gene name	Heterogeneous nuclear ribonucleoprotein H1
Gene symbol	HNRNPH1
Synonyms (NCBI Gene)	HNRPHHNRPH1NEDCDShnRNPH
Chromosome	5
Chromosome location	5q35.3
Summary	This gene encodes a member of a subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA. These proteins are associated with pre-mRNAs in the nuc

335

Show/Hide all (335)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023563	hsa-miR-1-3p	Proteomics	18668040
MIRT030723	hsa-miR-21-5p	Microarray	18591254
MIRT048075	hsa-miR-197-3p	CLASH	23622248
MIRT048075	hsa-miR-197-3p	CLASH	23622248
MIRT047811	hsa-miR-30d-5p	CLASH	23622248
MIRT046766	hsa-miR-222-3p	CLASH	23622248
MIRT045394	hsa-miR-149-5p	CLASH	23622248
MIRT043417	hsa-miR-331-3p	CLASH	23622248
MIRT041384	hsa-miR-193b-3p	CLASH	23622248
MIRT036968	hsa-miR-877-3p	CLASH	23622248
MIRT1051475	hsa-miR-1183	CLIP-seq
MIRT1051476	hsa-miR-1208	CLIP-seq
MIRT1051477	hsa-miR-1243	CLIP-seq
MIRT1051478	hsa-miR-1245	CLIP-seq
MIRT1051479	hsa-miR-1264	CLIP-seq
MIRT1051480	hsa-miR-1305	CLIP-seq
MIRT1051481	hsa-miR-1468	CLIP-seq
MIRT1051482	hsa-miR-154	CLIP-seq
MIRT1051483	hsa-miR-181a	CLIP-seq
MIRT1051484	hsa-miR-181b	CLIP-seq
MIRT1051485	hsa-miR-181c	CLIP-seq
MIRT1051486	hsa-miR-181d	CLIP-seq
MIRT1051487	hsa-miR-200b	CLIP-seq
MIRT1051488	hsa-miR-200c	CLIP-seq
MIRT1051489	hsa-miR-2115	CLIP-seq
MIRT1051490	hsa-miR-22	CLIP-seq
MIRT1051491	hsa-miR-25	CLIP-seq
MIRT1051492	hsa-miR-2861	CLIP-seq
MIRT1051493	hsa-miR-298	CLIP-seq
MIRT1051494	hsa-miR-3129-3p	CLIP-seq
MIRT1051495	hsa-miR-3146	CLIP-seq
MIRT1051496	hsa-miR-3177-3p	CLIP-seq
MIRT1051497	hsa-miR-32	CLIP-seq
MIRT1051498	hsa-miR-320a	CLIP-seq
MIRT1051499	hsa-miR-320b	CLIP-seq
MIRT1051500	hsa-miR-320c	CLIP-seq
MIRT1051501	hsa-miR-320d	CLIP-seq
MIRT1051502	hsa-miR-324-5p	CLIP-seq
MIRT1051503	hsa-miR-337-3p	CLIP-seq
MIRT1051504	hsa-miR-3613-3p	CLIP-seq
MIRT1051505	hsa-miR-363	CLIP-seq
MIRT1051506	hsa-miR-3646	CLIP-seq
MIRT1051507	hsa-miR-3654	CLIP-seq
MIRT1051508	hsa-miR-367	CLIP-seq
MIRT1051509	hsa-miR-3678-3p	CLIP-seq
MIRT1051510	hsa-miR-3688-5p	CLIP-seq
MIRT1051511	hsa-miR-3692	CLIP-seq
MIRT1051512	hsa-miR-371-5p	CLIP-seq
MIRT1051513	hsa-miR-371b-5p	CLIP-seq
MIRT1051514	hsa-miR-383	CLIP-seq
MIRT1051515	hsa-miR-411	CLIP-seq
MIRT1051516	hsa-miR-421	CLIP-seq
MIRT1051517	hsa-miR-4255	CLIP-seq
MIRT1051518	hsa-miR-4268	CLIP-seq
MIRT1051519	hsa-miR-4272	CLIP-seq
MIRT1051520	hsa-miR-429	CLIP-seq
MIRT1051521	hsa-miR-4305	CLIP-seq
MIRT1051522	hsa-miR-4420	CLIP-seq
MIRT1051523	hsa-miR-4422	CLIP-seq
MIRT1051524	hsa-miR-4429	CLIP-seq
MIRT1051525	hsa-miR-4436b-5p	CLIP-seq
MIRT1051526	hsa-miR-4446-5p	CLIP-seq
MIRT1051527	hsa-miR-4448	CLIP-seq
MIRT1051528	hsa-miR-4457	CLIP-seq
MIRT1051529	hsa-miR-4470	CLIP-seq
MIRT1051530	hsa-miR-4477a	CLIP-seq
MIRT1051531	hsa-miR-4637	CLIP-seq
MIRT1051532	hsa-miR-4638-3p	CLIP-seq
MIRT1051533	hsa-miR-4668-3p	CLIP-seq
MIRT1051534	hsa-miR-4670-3p	CLIP-seq
MIRT1051535	hsa-miR-4698	CLIP-seq
MIRT1051536	hsa-miR-4720-3p	CLIP-seq
MIRT1051537	hsa-miR-4738-3p	CLIP-seq
MIRT1051538	hsa-miR-4804-3p	CLIP-seq
MIRT1051539	hsa-miR-495	CLIP-seq
MIRT1051540	hsa-miR-496	CLIP-seq
MIRT1051541	hsa-miR-5095	CLIP-seq
MIRT1051542	hsa-miR-510	CLIP-seq
MIRT1051543	hsa-miR-511	CLIP-seq
MIRT1051544	hsa-miR-512-5p	CLIP-seq
MIRT1051545	hsa-miR-513b	CLIP-seq
MIRT1051546	hsa-miR-520d-5p	CLIP-seq
MIRT1051547	hsa-miR-524-5p	CLIP-seq
MIRT1051548	hsa-miR-539	CLIP-seq
MIRT1051549	hsa-miR-548g	CLIP-seq
MIRT1051550	hsa-miR-552	CLIP-seq
MIRT1051551	hsa-miR-563	CLIP-seq
MIRT1051552	hsa-miR-580	CLIP-seq
MIRT1051553	hsa-miR-600	CLIP-seq
MIRT1051554	hsa-miR-630	CLIP-seq
MIRT1051555	hsa-miR-633	CLIP-seq
MIRT1051556	hsa-miR-643	CLIP-seq
MIRT1051557	hsa-miR-92a	CLIP-seq
MIRT1051558	hsa-miR-92b	CLIP-seq
MIRT1051476	hsa-miR-1208	CLIP-seq
MIRT1051477	hsa-miR-1243	CLIP-seq
MIRT1051480	hsa-miR-1305	CLIP-seq
MIRT1051481	hsa-miR-1468	CLIP-seq
MIRT1051483	hsa-miR-181a	CLIP-seq
MIRT1051484	hsa-miR-181b	CLIP-seq
MIRT1051485	hsa-miR-181c	CLIP-seq
MIRT1051486	hsa-miR-181d	CLIP-seq
MIRT1051491	hsa-miR-25	CLIP-seq
MIRT1051493	hsa-miR-298	CLIP-seq
MIRT2011745	hsa-miR-3144-3p	CLIP-seq
MIRT1051495	hsa-miR-3146	CLIP-seq
MIRT2011746	hsa-miR-3173-3p	CLIP-seq
MIRT1051497	hsa-miR-32	CLIP-seq
MIRT1051502	hsa-miR-324-5p	CLIP-seq
MIRT1051503	hsa-miR-337-3p	CLIP-seq
MIRT1051504	hsa-miR-3613-3p	CLIP-seq
MIRT1051505	hsa-miR-363	CLIP-seq
MIRT1051507	hsa-miR-3654	CLIP-seq
MIRT1051508	hsa-miR-367	CLIP-seq
MIRT1051509	hsa-miR-3678-3p	CLIP-seq
MIRT1051510	hsa-miR-3688-5p	CLIP-seq
MIRT1051516	hsa-miR-421	CLIP-seq
MIRT1051517	hsa-miR-4255	CLIP-seq
MIRT1051519	hsa-miR-4272	CLIP-seq
MIRT1051521	hsa-miR-4305	CLIP-seq
MIRT1051522	hsa-miR-4420	CLIP-seq
MIRT1051523	hsa-miR-4422	CLIP-seq
MIRT1051528	hsa-miR-4457	CLIP-seq
MIRT1051529	hsa-miR-4470	CLIP-seq
MIRT1051532	hsa-miR-4638-3p	CLIP-seq
MIRT2011747	hsa-miR-4666-3p	CLIP-seq
MIRT1051534	hsa-miR-4670-3p	CLIP-seq
MIRT1051537	hsa-miR-4738-3p	CLIP-seq
MIRT1051540	hsa-miR-496	CLIP-seq
MIRT1051542	hsa-miR-510	CLIP-seq
MIRT1051543	hsa-miR-511	CLIP-seq
MIRT1051544	hsa-miR-512-5p	CLIP-seq
MIRT1051545	hsa-miR-513b	CLIP-seq
MIRT2011748	hsa-miR-514	CLIP-seq
MIRT2011749	hsa-miR-514b-3p	CLIP-seq
MIRT1051546	hsa-miR-520d-5p	CLIP-seq
MIRT1051547	hsa-miR-524-5p	CLIP-seq
MIRT1051549	hsa-miR-548g	CLIP-seq
MIRT1051554	hsa-miR-630	CLIP-seq
MIRT1051556	hsa-miR-643	CLIP-seq
MIRT2011750	hsa-miR-875-5p	CLIP-seq
MIRT1051557	hsa-miR-92a	CLIP-seq
MIRT1051558	hsa-miR-92b	CLIP-seq
MIRT1051475	hsa-miR-1183	CLIP-seq
MIRT1051476	hsa-miR-1208	CLIP-seq
MIRT1051477	hsa-miR-1243	CLIP-seq
MIRT1051478	hsa-miR-1245	CLIP-seq
MIRT1051479	hsa-miR-1264	CLIP-seq
MIRT2244009	hsa-miR-132	CLIP-seq
MIRT1051481	hsa-miR-1468	CLIP-seq
MIRT1051483	hsa-miR-181a	CLIP-seq
MIRT1051484	hsa-miR-181b	CLIP-seq
MIRT1051485	hsa-miR-181c	CLIP-seq
MIRT1051486	hsa-miR-181d	CLIP-seq
MIRT1051487	hsa-miR-200b	CLIP-seq
MIRT1051488	hsa-miR-200c	CLIP-seq
MIRT1051489	hsa-miR-2115	CLIP-seq
MIRT2244010	hsa-miR-212	CLIP-seq
MIRT1051490	hsa-miR-22	CLIP-seq
MIRT1051491	hsa-miR-25	CLIP-seq
MIRT1051492	hsa-miR-2861	CLIP-seq
MIRT1051493	hsa-miR-298	CLIP-seq
MIRT1051494	hsa-miR-3129-3p	CLIP-seq
MIRT2011745	hsa-miR-3144-3p	CLIP-seq
MIRT1051495	hsa-miR-3146	CLIP-seq
MIRT1051496	hsa-miR-3177-3p	CLIP-seq
MIRT2244011	hsa-miR-3189-3p	CLIP-seq
MIRT1051497	hsa-miR-32	CLIP-seq
MIRT1051498	hsa-miR-320a	CLIP-seq
MIRT1051499	hsa-miR-320b	CLIP-seq
MIRT1051500	hsa-miR-320c	CLIP-seq
MIRT1051501	hsa-miR-320d	CLIP-seq
MIRT2244012	hsa-miR-320e	CLIP-seq
MIRT1051503	hsa-miR-337-3p	CLIP-seq
MIRT1051504	hsa-miR-3613-3p	CLIP-seq
MIRT1051505	hsa-miR-363	CLIP-seq
MIRT1051507	hsa-miR-3654	CLIP-seq
MIRT1051508	hsa-miR-367	CLIP-seq
MIRT1051509	hsa-miR-3678-3p	CLIP-seq
MIRT1051511	hsa-miR-3692	CLIP-seq
MIRT1051514	hsa-miR-383	CLIP-seq
MIRT2244013	hsa-miR-3922-5p	CLIP-seq
MIRT2244014	hsa-miR-409-5p	CLIP-seq
MIRT1051515	hsa-miR-411	CLIP-seq
MIRT1051518	hsa-miR-4268	CLIP-seq
MIRT1051519	hsa-miR-4272	CLIP-seq
MIRT1051520	hsa-miR-429	CLIP-seq
MIRT1051521	hsa-miR-4305	CLIP-seq
MIRT1051522	hsa-miR-4420	CLIP-seq
MIRT1051524	hsa-miR-4429	CLIP-seq
MIRT1051525	hsa-miR-4436b-5p	CLIP-seq
MIRT1051527	hsa-miR-4448	CLIP-seq
MIRT1051528	hsa-miR-4457	CLIP-seq
MIRT1051531	hsa-miR-4637	CLIP-seq
MIRT1051532	hsa-miR-4638-3p	CLIP-seq
MIRT2011747	hsa-miR-4666-3p	CLIP-seq
MIRT1051535	hsa-miR-4698	CLIP-seq
MIRT1051536	hsa-miR-4720-3p	CLIP-seq
MIRT1051537	hsa-miR-4738-3p	CLIP-seq
MIRT1051538	hsa-miR-4804-3p	CLIP-seq
MIRT2244015	hsa-miR-485-3p	CLIP-seq
MIRT1051540	hsa-miR-496	CLIP-seq
MIRT1051542	hsa-miR-510	CLIP-seq
MIRT1051544	hsa-miR-512-5p	CLIP-seq
MIRT1051545	hsa-miR-513b	CLIP-seq
MIRT2011748	hsa-miR-514	CLIP-seq
MIRT2011749	hsa-miR-514b-3p	CLIP-seq
MIRT1051548	hsa-miR-539	CLIP-seq
MIRT1051549	hsa-miR-548g	CLIP-seq
MIRT1051552	hsa-miR-580	CLIP-seq
MIRT1051554	hsa-miR-630	CLIP-seq
MIRT1051555	hsa-miR-633	CLIP-seq
MIRT1051556	hsa-miR-643	CLIP-seq
MIRT2011750	hsa-miR-875-5p	CLIP-seq
MIRT1051557	hsa-miR-92a	CLIP-seq
MIRT1051558	hsa-miR-92b	CLIP-seq
MIRT1051542	hsa-miR-510	CLIP-seq
MIRT1051544	hsa-miR-512-5p	CLIP-seq
MIRT1051475	hsa-miR-1183	CLIP-seq
MIRT1051481	hsa-miR-1468	CLIP-seq
MIRT1051489	hsa-miR-2115	CLIP-seq
MIRT1051495	hsa-miR-3146	CLIP-seq
MIRT1051496	hsa-miR-3177-3p	CLIP-seq
MIRT1051521	hsa-miR-4305	CLIP-seq
MIRT1051525	hsa-miR-4436b-5p	CLIP-seq
MIRT1051476	hsa-miR-1208	CLIP-seq
MIRT1051479	hsa-miR-1264	CLIP-seq
MIRT1051480	hsa-miR-1305	CLIP-seq
MIRT2244009	hsa-miR-132	CLIP-seq
MIRT1051482	hsa-miR-154	CLIP-seq
MIRT1051487	hsa-miR-200b	CLIP-seq
MIRT1051488	hsa-miR-200c	CLIP-seq
MIRT2244010	hsa-miR-212	CLIP-seq
MIRT1051492	hsa-miR-2861	CLIP-seq
MIRT1051494	hsa-miR-3129-3p	CLIP-seq
MIRT2547044	hsa-miR-3140-3p	CLIP-seq
MIRT2547045	hsa-miR-3143	CLIP-seq
MIRT2011745	hsa-miR-3144-3p	CLIP-seq
MIRT1051498	hsa-miR-320a	CLIP-seq
MIRT1051499	hsa-miR-320b	CLIP-seq
MIRT1051500	hsa-miR-320c	CLIP-seq
MIRT1051501	hsa-miR-320d	CLIP-seq
MIRT2244012	hsa-miR-320e	CLIP-seq
MIRT1051502	hsa-miR-324-5p	CLIP-seq
MIRT1051503	hsa-miR-337-3p	CLIP-seq
MIRT2547046	hsa-miR-3591-3p	CLIP-seq
MIRT1051504	hsa-miR-3613-3p	CLIP-seq
MIRT1051506	hsa-miR-3646	CLIP-seq
MIRT1051510	hsa-miR-3688-5p	CLIP-seq
MIRT1051511	hsa-miR-3692	CLIP-seq
MIRT2244013	hsa-miR-3922-5p	CLIP-seq
MIRT1051515	hsa-miR-411	CLIP-seq
MIRT1051516	hsa-miR-421	CLIP-seq
MIRT1051517	hsa-miR-4255	CLIP-seq
MIRT1051519	hsa-miR-4272	CLIP-seq
MIRT1051520	hsa-miR-429	CLIP-seq
MIRT1051522	hsa-miR-4420	CLIP-seq
MIRT1051523	hsa-miR-4422	CLIP-seq
MIRT1051524	hsa-miR-4429	CLIP-seq
MIRT1051525	hsa-miR-4436b-5p	CLIP-seq
MIRT1051529	hsa-miR-4470	CLIP-seq
MIRT1051530	hsa-miR-4477a	CLIP-seq
MIRT1051531	hsa-miR-4637	CLIP-seq
MIRT2011747	hsa-miR-4666-3p	CLIP-seq
MIRT1051535	hsa-miR-4698	CLIP-seq
MIRT1051536	hsa-miR-4720-3p	CLIP-seq
MIRT1051537	hsa-miR-4738-3p	CLIP-seq
MIRT2547047	hsa-miR-4760-3p	CLIP-seq
MIRT2547048	hsa-miR-4803	CLIP-seq
MIRT1051538	hsa-miR-4804-3p	CLIP-seq
MIRT2244015	hsa-miR-485-3p	CLIP-seq
MIRT1051539	hsa-miR-495	CLIP-seq
MIRT1051540	hsa-miR-496	CLIP-seq
MIRT1051541	hsa-miR-5095	CLIP-seq
MIRT1051542	hsa-miR-510	CLIP-seq
MIRT1051543	hsa-miR-511	CLIP-seq
MIRT1051544	hsa-miR-512-5p	CLIP-seq
MIRT1051546	hsa-miR-520d-5p	CLIP-seq
MIRT1051547	hsa-miR-524-5p	CLIP-seq
MIRT1051548	hsa-miR-539	CLIP-seq
MIRT1051550	hsa-miR-552	CLIP-seq
MIRT1051552	hsa-miR-580	CLIP-seq
MIRT1051554	hsa-miR-630	CLIP-seq
MIRT1051555	hsa-miR-633	CLIP-seq
MIRT2011750	hsa-miR-875-5p	CLIP-seq
MIRT1051476	hsa-miR-1208	CLIP-seq
MIRT1051479	hsa-miR-1264	CLIP-seq
MIRT1051480	hsa-miR-1305	CLIP-seq
MIRT2244009	hsa-miR-132	CLIP-seq
MIRT1051487	hsa-miR-200b	CLIP-seq
MIRT1051488	hsa-miR-200c	CLIP-seq
MIRT2244010	hsa-miR-212	CLIP-seq
MIRT1051492	hsa-miR-2861	CLIP-seq
MIRT1051494	hsa-miR-3129-3p	CLIP-seq
MIRT2547044	hsa-miR-3140-3p	CLIP-seq
MIRT2547045	hsa-miR-3143	CLIP-seq
MIRT2011745	hsa-miR-3144-3p	CLIP-seq
MIRT1051498	hsa-miR-320a	CLIP-seq
MIRT1051499	hsa-miR-320b	CLIP-seq
MIRT1051500	hsa-miR-320c	CLIP-seq
MIRT1051501	hsa-miR-320d	CLIP-seq
MIRT2244012	hsa-miR-320e	CLIP-seq
MIRT1051502	hsa-miR-324-5p	CLIP-seq
MIRT1051503	hsa-miR-337-3p	CLIP-seq
MIRT2547046	hsa-miR-3591-3p	CLIP-seq
MIRT1051504	hsa-miR-3613-3p	CLIP-seq
MIRT1051510	hsa-miR-3688-5p	CLIP-seq
MIRT1051511	hsa-miR-3692	CLIP-seq
MIRT2244013	hsa-miR-3922-5p	CLIP-seq
MIRT1051516	hsa-miR-421	CLIP-seq
MIRT1051517	hsa-miR-4255	CLIP-seq
MIRT1051519	hsa-miR-4272	CLIP-seq
MIRT1051520	hsa-miR-429	CLIP-seq
MIRT1051522	hsa-miR-4420	CLIP-seq
MIRT1051523	hsa-miR-4422	CLIP-seq
MIRT1051524	hsa-miR-4429	CLIP-seq
MIRT1051525	hsa-miR-4436b-5p	CLIP-seq
MIRT1051529	hsa-miR-4470	CLIP-seq
MIRT1051531	hsa-miR-4637	CLIP-seq
MIRT2011747	hsa-miR-4666-3p	CLIP-seq
MIRT1051536	hsa-miR-4720-3p	CLIP-seq
MIRT2547047	hsa-miR-4760-3p	CLIP-seq
MIRT2547048	hsa-miR-4803	CLIP-seq
MIRT1051538	hsa-miR-4804-3p	CLIP-seq
MIRT2244015	hsa-miR-485-3p	CLIP-seq
MIRT1051540	hsa-miR-496	CLIP-seq
MIRT1051542	hsa-miR-510	CLIP-seq
MIRT1051543	hsa-miR-511	CLIP-seq
MIRT1051544	hsa-miR-512-5p	CLIP-seq
MIRT1051546	hsa-miR-520d-5p	CLIP-seq
MIRT1051547	hsa-miR-524-5p	CLIP-seq
MIRT1051548	hsa-miR-539	CLIP-seq
MIRT1051552	hsa-miR-580	CLIP-seq
MIRT1051554	hsa-miR-630	CLIP-seq
MIRT2011750	hsa-miR-875-5p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	16946708
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9111328, 16946708, 17289661, 24910439, 24965446, 29725819, 32296183, 32814053, 35271311
GO:0005634	Component	Nucleus	IDA	24910439
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7499401
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006396	Process	RNA processing	TAS	7499401
GO:0006397	Process	MRNA processing	IEA
GO:0008266	Function	Poly(U) RNA binding	TAS	7499401
GO:0008380	Process	RNA splicing	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043484	Process	Regulation of RNA splicing	IBA
GO:0043484	Process	Regulation of RNA splicing	IDA	16946708
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
601035	5041	ENSG00000169045

P31943

Protein name

Heterogeneous nuclear ribonucleoprotein H (hnRNP H) [Cleaved into: Heterogeneous nuclear ribonucleoprotein H, N-terminally processed]

Protein function

This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates p

PDB

2LXU , 6DHS , 7ZUG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	13 → 84	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	113 → 182	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF08080	zf-RNPHF	255 → 290	RNPHF zinc finger	Domain
PF00076	RRM_1	291 → 358	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed ubiquitously.

Sequence

MMLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVE
LESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPF
GCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRY
IEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGY
GGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRA
TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKANMQHRYVELF
LNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY
GGGYGGQSSMSGYDQVLQENSSDFQSNIA

Sequence length

449

Interactions

View interactions

	Reactome
			FGFR2 alternative splicing mRNA Splicing - Major Pathway Processing of Capped Intron-Containing Pre-mRNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual disability, X-linked, syndromic, Bain type	Likely pathogenic	rs1772040461	RCV001175254	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with craniofacial dysmorphism and skeletal defects	Pathogenic	rs2532711449, rs2532547259, rs2532711553, rs1770718566	RCV002293287 RCV002293288 RCV002293289 RCV002293253	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HNRNPH1-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, X-LINKED, SYNDROMIC, BAIN TYPE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DELAY-BRAIN MALFORMATIONS-SKELETAL DEFECTS-INTELLECTUAL DISABILITY SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	22303960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24290757, 26192745, 27623008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	24866055, 33055097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	26192745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25264628, 26367347, 30468106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27088854, 29252188, 36499164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32630435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29252188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27621578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	24290757, 27623008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	33055097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29938792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37400142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16732326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27088854, 29252188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29252188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17566973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26553749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20145135, 30120239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	29938792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes, Congenital	Myasthenic Syndrome	BEFREE	18806275, 19147685, 26282582		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	16946708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27621578, 29252188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19360007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	ORPHANET_DG	23673860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26553749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17566973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26553749		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26553749, 37143720	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36514015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29362363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	26776507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27621578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36593250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HNRNPH1 (heterogeneous nuclear ribonucleoprotein H1)