HNRNPD (heterogeneous nuclear ribonucleoprotein D)

Gene

• Entrez ID: 3184
• Gene name: Heterogeneous nuclear ribonucleoprotein D
• Gene symbol: HNRNPD
• Synonyms (NCBI Gene): AUF1, AUF1A, HNRPD, P37, hnRNPD0
• Chromosome: 4
• Chromosome location: 4q21.22
• Summary: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mR

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004177	hsa-miR-197-3p	Microarray	16822819
MIRT024012	hsa-miR-1-3p	Proteomics	18668040
MIRT024179	hsa-miR-221-3p	Sequencing	20371350
MIRT046797	hsa-miR-222-3p	CLASH	23622248
MIRT040890	hsa-miR-18a-3p	CLASH	23622248
MIRT036291	hsa-miR-1229-3p	CLASH	23622248
MIRT437903	hsa-miR-146b-5p	Luciferase reporter assay, Western blot	25261470
MIRT437904	hsa-miR-141-3p	Luciferase reporter assay, Western blot	25261470
MIRT437904	hsa-miR-141-3p	Luciferase reporter assay, Western blot	25261470
MIRT536789	hsa-miR-4450	PAR-CLIP	22012620
MIRT536790	hsa-miR-4425	PAR-CLIP	22012620
MIRT536788	hsa-miR-3147	PAR-CLIP	22012620
MIRT536787	hsa-miR-2110	PAR-CLIP	22012620
MIRT536786	hsa-miR-6810-5p	PAR-CLIP	22012620
MIRT536785	hsa-miR-3150a-3p	PAR-CLIP	22012620
MIRT536784	hsa-miR-6763-5p	PAR-CLIP	22012620
MIRT536783	hsa-miR-6857-5p	PAR-CLIP	22012620
MIRT536782	hsa-miR-450a-2-3p	PAR-CLIP	22012620
MIRT536781	hsa-miR-548aa	PAR-CLIP	22012620
MIRT536780	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT536779	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT536778	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT536777	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT536776	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT536774	hsa-miR-6782-3p	PAR-CLIP	22012620
MIRT536775	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536773	hsa-miR-18b-3p	PAR-CLIP	22012620
MIRT734002	hsa-miR-146a-5p	Immunocytochemistry (ICC), Luciferase reporter assay, qRT-PCR, Western blotting	32452829
MIRT536789	hsa-miR-4450	PAR-CLIP	22012620
MIRT536790	hsa-miR-4425	PAR-CLIP	22012620
MIRT536788	hsa-miR-3147	PAR-CLIP	22012620
MIRT536787	hsa-miR-2110	PAR-CLIP	22012620
MIRT536786	hsa-miR-6810-5p	PAR-CLIP	22012620
MIRT536785	hsa-miR-3150a-3p	PAR-CLIP	22012620
MIRT536784	hsa-miR-6763-5p	PAR-CLIP	22012620
MIRT536783	hsa-miR-6857-5p	PAR-CLIP	22012620
MIRT536782	hsa-miR-450a-2-3p	PAR-CLIP	22012620
MIRT536781	hsa-miR-548aa	PAR-CLIP	22012620
MIRT536780	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT536779	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT536778	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT536777	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT536776	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT536774	hsa-miR-6782-3p	PAR-CLIP	22012620
MIRT536775	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536773	hsa-miR-18b-3p	PAR-CLIP	22012620
MIRT1051331	hsa-miR-105	CLIP-seq
MIRT1051332	hsa-miR-1207-5p	CLIP-seq
MIRT1051333	hsa-miR-1275	CLIP-seq
MIRT1051334	hsa-miR-1276	CLIP-seq
MIRT1051335	hsa-miR-1283	CLIP-seq
MIRT1051336	hsa-miR-146a	CLIP-seq
MIRT1051337	hsa-miR-197	CLIP-seq
MIRT1051338	hsa-miR-200b	CLIP-seq
MIRT1051339	hsa-miR-200c	CLIP-seq
MIRT1051340	hsa-miR-300	CLIP-seq
MIRT1051341	hsa-miR-3117-5p	CLIP-seq
MIRT1051342	hsa-miR-3119	CLIP-seq
MIRT1051343	hsa-miR-3126-5p	CLIP-seq
MIRT1051344	hsa-miR-3127-5p	CLIP-seq
MIRT1051345	hsa-miR-3148	CLIP-seq
MIRT1051346	hsa-miR-3153	CLIP-seq
MIRT1051347	hsa-miR-323b-3p	CLIP-seq
MIRT1051348	hsa-miR-337-3p	CLIP-seq
MIRT1051349	hsa-miR-338-5p	CLIP-seq
MIRT1051350	hsa-miR-3617	CLIP-seq
MIRT1051351	hsa-miR-3646	CLIP-seq
MIRT1051352	hsa-miR-3653	CLIP-seq
MIRT1051353	hsa-miR-3658	CLIP-seq
MIRT1051354	hsa-miR-3665	CLIP-seq
MIRT1051355	hsa-miR-3671	CLIP-seq
MIRT1051356	hsa-miR-3682-3p	CLIP-seq
MIRT1051357	hsa-miR-3685	CLIP-seq
MIRT1051358	hsa-miR-378g	CLIP-seq
MIRT1051359	hsa-miR-381	CLIP-seq
MIRT1051360	hsa-miR-382	CLIP-seq
MIRT1051361	hsa-miR-384	CLIP-seq
MIRT1051362	hsa-miR-3908	CLIP-seq
MIRT1051363	hsa-miR-3942-5p	CLIP-seq
MIRT1051364	hsa-miR-3945	CLIP-seq
MIRT1051365	hsa-miR-3977	CLIP-seq
MIRT1051366	hsa-miR-3978	CLIP-seq
MIRT1051367	hsa-miR-412	CLIP-seq
MIRT1051368	hsa-miR-425	CLIP-seq
MIRT1051369	hsa-miR-4257	CLIP-seq
MIRT1051370	hsa-miR-4270	CLIP-seq
MIRT1051371	hsa-miR-429	CLIP-seq
MIRT1051372	hsa-miR-4441	CLIP-seq
MIRT1051373	hsa-miR-4477a	CLIP-seq
MIRT1051374	hsa-miR-4502	CLIP-seq
MIRT1051375	hsa-miR-4525	CLIP-seq
MIRT1051376	hsa-miR-4665-5p	CLIP-seq
MIRT1051377	hsa-miR-4666-3p	CLIP-seq
MIRT1051378	hsa-miR-4690-5p	CLIP-seq
MIRT1051379	hsa-miR-4703-5p	CLIP-seq
MIRT1051380	hsa-miR-4719	CLIP-seq
MIRT1051381	hsa-miR-4722-5p	CLIP-seq
MIRT1051382	hsa-miR-4723-5p	CLIP-seq
MIRT1051383	hsa-miR-4731-3p	CLIP-seq
MIRT1051384	hsa-miR-4736	CLIP-seq
MIRT1051385	hsa-miR-4761-3p	CLIP-seq
MIRT1051386	hsa-miR-4762-3p	CLIP-seq
MIRT1051387	hsa-miR-4763-3p	CLIP-seq
MIRT1051388	hsa-miR-4766-3p	CLIP-seq
MIRT1051389	hsa-miR-4778-5p	CLIP-seq
MIRT1051390	hsa-miR-4789-5p	CLIP-seq
MIRT1051391	hsa-miR-4801	CLIP-seq
MIRT1051392	hsa-miR-499-3p	CLIP-seq
MIRT1051393	hsa-miR-499a-3p	CLIP-seq
MIRT1051394	hsa-miR-513a-3p	CLIP-seq
MIRT1051395	hsa-miR-548ac	CLIP-seq
MIRT1051396	hsa-miR-548d-3p	CLIP-seq
MIRT1051397	hsa-miR-548z	CLIP-seq
MIRT1051398	hsa-miR-589	CLIP-seq
MIRT1051399	hsa-miR-598	CLIP-seq
MIRT1051400	hsa-miR-607	CLIP-seq
MIRT1051401	hsa-miR-625	CLIP-seq
MIRT1051402	hsa-miR-637	CLIP-seq
MIRT1051403	hsa-miR-641	CLIP-seq
MIRT1051404	hsa-miR-711	CLIP-seq
MIRT1051343	hsa-miR-3126-5p	CLIP-seq
MIRT1051344	hsa-miR-3127-5p	CLIP-seq
MIRT1051369	hsa-miR-4257	CLIP-seq
MIRT1051370	hsa-miR-4270	CLIP-seq
MIRT1051372	hsa-miR-4441	CLIP-seq
MIRT1051399	hsa-miR-598	CLIP-seq
MIRT1051404	hsa-miR-711	CLIP-seq
MIRT1051355	hsa-miR-3671	CLIP-seq
MIRT1051400	hsa-miR-607	CLIP-seq
MIRT1051355	hsa-miR-3671	CLIP-seq
MIRT1051400	hsa-miR-607	CLIP-seq
MIRT1051331	hsa-miR-105	CLIP-seq
MIRT1051332	hsa-miR-1207-5p	CLIP-seq
MIRT1051333	hsa-miR-1275	CLIP-seq
MIRT1051335	hsa-miR-1283	CLIP-seq
MIRT1051336	hsa-miR-146a	CLIP-seq
MIRT1051337	hsa-miR-197	CLIP-seq
MIRT1051338	hsa-miR-200b	CLIP-seq
MIRT1051339	hsa-miR-200c	CLIP-seq
MIRT2244000	hsa-miR-3065-5p	CLIP-seq
MIRT1051341	hsa-miR-3117-5p	CLIP-seq
MIRT1051342	hsa-miR-3119	CLIP-seq
MIRT1051343	hsa-miR-3126-5p	CLIP-seq
MIRT1051344	hsa-miR-3127-5p	CLIP-seq
MIRT1051345	hsa-miR-3148	CLIP-seq
MIRT1051346	hsa-miR-3153	CLIP-seq
MIRT1051349	hsa-miR-338-5p	CLIP-seq
MIRT2244001	hsa-miR-3545-3p	CLIP-seq
MIRT1051350	hsa-miR-3617	CLIP-seq
MIRT1051351	hsa-miR-3646	CLIP-seq
MIRT1051355	hsa-miR-3671	CLIP-seq
MIRT1051358	hsa-miR-378g	CLIP-seq
MIRT1051360	hsa-miR-382	CLIP-seq
MIRT1051364	hsa-miR-3945	CLIP-seq
MIRT1051365	hsa-miR-3977	CLIP-seq
MIRT1051366	hsa-miR-3978	CLIP-seq
MIRT1051367	hsa-miR-412	CLIP-seq
MIRT1051368	hsa-miR-425	CLIP-seq
MIRT1051369	hsa-miR-4257	CLIP-seq
MIRT1051370	hsa-miR-4270	CLIP-seq
MIRT2244002	hsa-miR-4282	CLIP-seq
MIRT1051371	hsa-miR-429	CLIP-seq
MIRT1051372	hsa-miR-4441	CLIP-seq
MIRT1051373	hsa-miR-4477a	CLIP-seq
MIRT2244003	hsa-miR-4524	CLIP-seq
MIRT1051375	hsa-miR-4525	CLIP-seq
MIRT1051376	hsa-miR-4665-5p	CLIP-seq
MIRT2244004	hsa-miR-4684-3p	CLIP-seq
MIRT2244005	hsa-miR-4694-3p	CLIP-seq
MIRT1051380	hsa-miR-4719	CLIP-seq
MIRT1051381	hsa-miR-4722-5p	CLIP-seq
MIRT1051382	hsa-miR-4723-5p	CLIP-seq
MIRT1051383	hsa-miR-4731-3p	CLIP-seq
MIRT1051384	hsa-miR-4736	CLIP-seq
MIRT1051385	hsa-miR-4761-3p	CLIP-seq
MIRT1051387	hsa-miR-4763-3p	CLIP-seq
MIRT1051391	hsa-miR-4801	CLIP-seq
MIRT2244006	hsa-miR-495	CLIP-seq
MIRT1051392	hsa-miR-499-3p	CLIP-seq
MIRT1051393	hsa-miR-499a-3p	CLIP-seq
MIRT2244007	hsa-miR-518a-5p	CLIP-seq
MIRT2244008	hsa-miR-527	CLIP-seq
MIRT1051395	hsa-miR-548ac	CLIP-seq
MIRT1051396	hsa-miR-548d-3p	CLIP-seq
MIRT1051397	hsa-miR-548z	CLIP-seq
MIRT1051398	hsa-miR-589	CLIP-seq
MIRT1051399	hsa-miR-598	CLIP-seq
MIRT1051400	hsa-miR-607	CLIP-seq
MIRT1051401	hsa-miR-625	CLIP-seq
MIRT1051402	hsa-miR-637	CLIP-seq
MIRT1051403	hsa-miR-641	CLIP-seq
MIRT1051404	hsa-miR-711	CLIP-seq
MIRT2244007	hsa-miR-518a-5p	CLIP-seq
MIRT2244008	hsa-miR-527	CLIP-seq
MIRT1051341	hsa-miR-3117-5p	CLIP-seq
MIRT1051342	hsa-miR-3119	CLIP-seq
MIRT1051343	hsa-miR-3126-5p	CLIP-seq
MIRT1051344	hsa-miR-3127-5p	CLIP-seq
MIRT1051358	hsa-miR-378g	CLIP-seq
MIRT1051369	hsa-miR-4257	CLIP-seq
MIRT1051370	hsa-miR-4270	CLIP-seq
MIRT1051372	hsa-miR-4441	CLIP-seq
MIRT1051383	hsa-miR-4731-3p	CLIP-seq
MIRT1051391	hsa-miR-4801	CLIP-seq
MIRT1051399	hsa-miR-598	CLIP-seq
MIRT1051404	hsa-miR-711	CLIP-seq
MIRT1051332	hsa-miR-1207-5p	CLIP-seq
MIRT1051333	hsa-miR-1275	CLIP-seq
MIRT1051335	hsa-miR-1283	CLIP-seq
MIRT1051336	hsa-miR-146a	CLIP-seq
MIRT1051338	hsa-miR-200b	CLIP-seq
MIRT1051339	hsa-miR-200c	CLIP-seq
MIRT1051342	hsa-miR-3119	CLIP-seq
MIRT1051346	hsa-miR-3153	CLIP-seq
MIRT1051349	hsa-miR-338-5p	CLIP-seq
MIRT2244001	hsa-miR-3545-3p	CLIP-seq
MIRT1051352	hsa-miR-3653	CLIP-seq
MIRT1051353	hsa-miR-3658	CLIP-seq
MIRT1051354	hsa-miR-3665	CLIP-seq
MIRT1051355	hsa-miR-3671	CLIP-seq
MIRT1051358	hsa-miR-378g	CLIP-seq
MIRT1051360	hsa-miR-382	CLIP-seq
MIRT1051362	hsa-miR-3908	CLIP-seq
MIRT1051363	hsa-miR-3942-5p	CLIP-seq
MIRT1051364	hsa-miR-3945	CLIP-seq
MIRT2244002	hsa-miR-4282	CLIP-seq
MIRT1051371	hsa-miR-429	CLIP-seq
MIRT2244003	hsa-miR-4524	CLIP-seq
MIRT1051375	hsa-miR-4525	CLIP-seq
MIRT1051376	hsa-miR-4665-5p	CLIP-seq
MIRT2244004	hsa-miR-4684-3p	CLIP-seq
MIRT1051378	hsa-miR-4690-5p	CLIP-seq
MIRT2244005	hsa-miR-4694-3p	CLIP-seq
MIRT1051379	hsa-miR-4703-5p	CLIP-seq
MIRT1051380	hsa-miR-4719	CLIP-seq
MIRT1051381	hsa-miR-4722-5p	CLIP-seq
MIRT1051382	hsa-miR-4723-5p	CLIP-seq
MIRT1051383	hsa-miR-4731-3p	CLIP-seq
MIRT1051384	hsa-miR-4736	CLIP-seq
MIRT1051385	hsa-miR-4761-3p	CLIP-seq
MIRT1051387	hsa-miR-4763-3p	CLIP-seq
MIRT1051388	hsa-miR-4766-3p	CLIP-seq
MIRT1051391	hsa-miR-4801	CLIP-seq
MIRT1051394	hsa-miR-513a-3p	CLIP-seq
MIRT2244007	hsa-miR-518a-5p	CLIP-seq
MIRT2244008	hsa-miR-527	CLIP-seq
MIRT1051398	hsa-miR-589	CLIP-seq
MIRT1051400	hsa-miR-607	CLIP-seq
MIRT1051401	hsa-miR-625	CLIP-seq
MIRT1051402	hsa-miR-637	CLIP-seq
MIRT1051332	hsa-miR-1207-5p	CLIP-seq
MIRT1051333	hsa-miR-1275	CLIP-seq
MIRT1051335	hsa-miR-1283	CLIP-seq
MIRT1051336	hsa-miR-146a	CLIP-seq
MIRT1051338	hsa-miR-200b	CLIP-seq
MIRT1051339	hsa-miR-200c	CLIP-seq
MIRT1051342	hsa-miR-3119	CLIP-seq
MIRT1051346	hsa-miR-3153	CLIP-seq
MIRT1051349	hsa-miR-338-5p	CLIP-seq
MIRT2244001	hsa-miR-3545-3p	CLIP-seq
MIRT1051352	hsa-miR-3653	CLIP-seq
MIRT1051353	hsa-miR-3658	CLIP-seq
MIRT1051354	hsa-miR-3665	CLIP-seq
MIRT1051358	hsa-miR-378g	CLIP-seq
MIRT1051362	hsa-miR-3908	CLIP-seq
MIRT1051363	hsa-miR-3942-5p	CLIP-seq
MIRT1051364	hsa-miR-3945	CLIP-seq
MIRT2244002	hsa-miR-4282	CLIP-seq
MIRT1051371	hsa-miR-429	CLIP-seq
MIRT2244003	hsa-miR-4524	CLIP-seq
MIRT1051375	hsa-miR-4525	CLIP-seq
MIRT1051376	hsa-miR-4665-5p	CLIP-seq
MIRT1051378	hsa-miR-4690-5p	CLIP-seq
MIRT1051379	hsa-miR-4703-5p	CLIP-seq
MIRT1051380	hsa-miR-4719	CLIP-seq
MIRT1051381	hsa-miR-4722-5p	CLIP-seq
MIRT1051382	hsa-miR-4723-5p	CLIP-seq
MIRT1051383	hsa-miR-4731-3p	CLIP-seq
MIRT1051384	hsa-miR-4736	CLIP-seq
MIRT1051385	hsa-miR-4761-3p	CLIP-seq
MIRT1051387	hsa-miR-4763-3p	CLIP-seq
MIRT1051388	hsa-miR-4766-3p	CLIP-seq
MIRT1051391	hsa-miR-4801	CLIP-seq
MIRT1051394	hsa-miR-513a-3p	CLIP-seq
MIRT1051398	hsa-miR-589	CLIP-seq
MIRT1051401	hsa-miR-625	CLIP-seq
MIRT1051402	hsa-miR-637	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0001889	Process	Liver development	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	8321232
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	NAS	3754960
GO:0003723	Function	RNA binding	TAS	10205060
GO:0003729	Function	MRNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12107167, 12674497, 16556936, 16902409, 22365833, 23603392, 24423872, 26496610, 30021884, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	1433497
GO:0005634	Component	Nucleus	TAS	10205060
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	11051545
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	1433497
GO:0006396	Process	RNA processing	TAS	10205060
GO:0006401	Process	RNA catabolic process	TAS	10205060
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	ISS
GO:0032355	Process	Response to estradiol	IEA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IEA
GO:0042162	Function	Telomeric DNA binding	IDA	8321232
GO:0042752	Process	Regulation of circadian rhythm	IMP	24423872
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0045202	Component	Synapse	IEA
GO:0045727	Process	Positive regulation of translation	IMP	24423872
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	1433497
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IEA
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	11051545
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071732	Process	Cellular response to nitric oxide	IEA
GO:0097167	Process	Circadian regulation of translation	IMP	24423872
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106002	Component	MCRD-mediated mRNA stability complex	IPI	11051545
GO:1900152	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	11051545
GO:1901355	Process	Response to rapamycin	IEA
GO:1904355	Process	Positive regulation of telomere capping	IEA
GO:1904355	Process	Positive regulation of telomere capping	ISS
GO:1904383	Process	Response to sodium phosphate	IEA
GO:1904586	Process	Cellular response to putrescine	IEA
GO:1990828	Process	Hepatocyte dedifferentiation	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:2000767	Process	Positive regulation of cytoplasmic translation	IDA	11051545

Other IDs

• MIM: 601324
• HGNC: 5036
• e!Ensembl: ENSG00000138668

Protein

• UniProt ID: Q14103
• Protein name: Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) (AU-rich element RNA-binding protein 1)
• Protein function: Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a trans
• PDB: 1HD0, 1HD1, 1IQT, 1WTB, 1X0F, 2Z5N, 5IM0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08143	CBFNT	1 → 78	CBFNT (NUC161) domain	Domain
  PF00076	RRM_1	99 → 168	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	184 → 255	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Sequence:

  MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGS
  AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKF
  GEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEP
  VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIM
  EKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQ
  GYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

• Sequence length: 355

Pathways

Reactome:

AUF1 (hnRNP D0) binds and destabilizes mRNA
mRNA Splicing - Major Pathway
Processing of Capped Intron-Containing Pre-mRNA

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COMPLEX NEURODEVELOPMENTAL DISORDER	—	ClinGen, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HNRNPD-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24564251		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18240226	Associate	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	33746583	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18240226		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	18240226		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18240226	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27578251		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30104251, 31071529		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25231991, 32414408, 35821051	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33016643, 35396527, 35821051	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24213928, 35178834, 37877357	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30104251, 31071529		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	27034373		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30349226		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30681073, 30927204		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30681073, 30927204, 30987669	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33016643	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11693200		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	18240226	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28300425		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28300425	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18240226		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30942443	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	26318153	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27826622		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11693200		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	8626551	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11693200		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22086907	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20102719, 22318685, 28036384, 28976984, 29599909, 30980864		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18240226	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18240226		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33016643	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	40598215	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21062494		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27683118		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30104251, 31071529		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21622178, 28036384, 30681073		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14585195		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14585195		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26318153, 35396527	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	31113881		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25428262		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21622178, 27826622		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24564251		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32255771	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25261470	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31448053		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25908445	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38423246	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30349226, 37483631	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	27575817		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	27575817	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	27575817	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31211828		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19015635		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24564251		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27826622		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19015635, 26318153, 31510782, 35396527	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21062494		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26805816	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	40598215	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19574297, 27683118		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27683118		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27683118	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31115480	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24013563, 35234917	Associate	★☆☆☆☆ Found in Text Mining only