HNRNPC (heterogeneous nuclear ribonucleoprotein C)

Gene

• Entrez ID: 3183
• Gene name: Heterogeneous nuclear ribonucleoprotein C
• Gene symbol: HNRNPC
• Synonyms (NCBI Gene): C1, C2, HNRNP, HNRPC, MRD74, SNRPC
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051596	hsa-let-7e-5p	CLASH	23622248
MIRT047904	hsa-miR-30c-5p	CLASH	23622248
MIRT045150	hsa-miR-186-5p	CLASH	23622248
MIRT043694	hsa-miR-342-3p	CLASH	23622248
MIRT042196	hsa-miR-484	CLASH	23622248
MIRT040851	hsa-miR-18a-3p	CLASH	23622248
MIRT039991	hsa-miR-615-3p	CLASH	23622248
MIRT039991	hsa-miR-615-3p	CLASH	23622248
MIRT037959	hsa-miR-505-5p	CLASH	23622248
MIRT037890	hsa-miR-455-3p	CLASH	23622248
MIRT037494	hsa-miR-744-5p	CLASH	23622248
MIRT667945	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT667944	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT657347	hsa-miR-1-5p	HITS-CLIP	23824327
MIRT277852	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT657346	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT657345	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT667943	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT667942	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT657344	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT341160	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT341161	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT657343	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT657341	hsa-miR-6828-3p	HITS-CLIP	23824327
MIRT657342	hsa-miR-6071	HITS-CLIP	23824327
MIRT657340	hsa-miR-544a	HITS-CLIP	23824327
MIRT657339	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT657348	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT657347	hsa-miR-1-5p	HITS-CLIP	23824327
MIRT277852	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT657346	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT657345	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657344	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT341160	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT341161	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT657343	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT657341	hsa-miR-6828-3p	HITS-CLIP	23824327
MIRT657342	hsa-miR-6071	HITS-CLIP	23824327
MIRT657340	hsa-miR-544a	HITS-CLIP	23824327
MIRT657339	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT574679	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT574678	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT574677	hsa-miR-4531	PAR-CLIP	20371350
MIRT574676	hsa-miR-1270	PAR-CLIP	20371350
MIRT574675	hsa-miR-620	PAR-CLIP	20371350
MIRT574674	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT571998	hsa-miR-4773	PAR-CLIP	20371350
MIRT571997	hsa-miR-4699-5p	PAR-CLIP	20371350
MIRT511477	hsa-miR-3133	PAR-CLIP	20371350
MIRT511476	hsa-miR-4511	PAR-CLIP	20371350
MIRT511475	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT511474	hsa-miR-4539	PAR-CLIP	20371350
MIRT511473	hsa-miR-3924	PAR-CLIP	20371350
MIRT511477	hsa-miR-3133	PAR-CLIP	20371350
MIRT511476	hsa-miR-4511	PAR-CLIP	20371350
MIRT511475	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT511474	hsa-miR-4539	PAR-CLIP	20371350
MIRT511473	hsa-miR-3924	PAR-CLIP	20371350
MIRT557229	hsa-miR-3139	PAR-CLIP	21572407
MIRT557228	hsa-miR-28-5p	PAR-CLIP	21572407
MIRT557227	hsa-miR-708-5p	PAR-CLIP	21572407
MIRT557226	hsa-miR-606	PAR-CLIP	21572407
MIRT557225	hsa-miR-6503-3p	PAR-CLIP	21572407
MIRT557224	hsa-miR-3199	PAR-CLIP	21572407
MIRT557222	hsa-miR-8052	PAR-CLIP	21572407
MIRT557223	hsa-miR-365a-5p	PAR-CLIP	21572407
MIRT557221	hsa-miR-365b-5p	PAR-CLIP	21572407
MIRT511477	hsa-miR-3133	PAR-CLIP	23446348
MIRT511476	hsa-miR-4511	PAR-CLIP	23446348
MIRT511475	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT511474	hsa-miR-4539	PAR-CLIP	23446348
MIRT511473	hsa-miR-3924	PAR-CLIP	23446348
MIRT502268	hsa-miR-224-5p	PAR-CLIP	24398324
MIRT502267	hsa-miR-548e-5p	PAR-CLIP	24398324
MIRT502266	hsa-miR-4311	PAR-CLIP	24398324
MIRT502265	hsa-miR-1276	PAR-CLIP	24398324
MIRT502264	hsa-miR-583	PAR-CLIP	24398324
MIRT502263	hsa-miR-548p	PAR-CLIP	24398324
MIRT502262	hsa-miR-8063	PAR-CLIP	24398324
MIRT502261	hsa-miR-4698	PAR-CLIP	24398324
MIRT502260	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT475577	hsa-miR-4517	PAR-CLIP	23592263
MIRT475576	hsa-miR-5090	PAR-CLIP	23592263
MIRT475575	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT037494	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT475574	hsa-miR-4533	PAR-CLIP	23592263
MIRT475573	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT475572	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT475571	hsa-miR-183-3p	PAR-CLIP	23592263
MIRT380416	hsa-miR-136-3p	HITS-CLIP	24374217
MIRT380416	hsa-miR-136-3p	HITS-CLIP	24374217
MIRT571997	hsa-miR-4699-5p	PAR-CLIP	26701625
MIRT502265	hsa-miR-1276	PAR-CLIP	27292025
MIRT502260	hsa-miR-202-3p	PAR-CLIP	27292025
MIRT502268	hsa-miR-224-5p	PAR-CLIP	27292025
MIRT557228	hsa-miR-28-5p	PAR-CLIP	27292025
MIRT557229	hsa-miR-3139	PAR-CLIP	27292025
MIRT502266	hsa-miR-4311	PAR-CLIP	27292025
MIRT502261	hsa-miR-4698	PAR-CLIP	27292025
MIRT502267	hsa-miR-548e-5p	PAR-CLIP	27292025
MIRT502263	hsa-miR-548p	PAR-CLIP	27292025
MIRT502264	hsa-miR-583	PAR-CLIP	27292025
MIRT557227	hsa-miR-708-5p	PAR-CLIP	27292025
MIRT502262	hsa-miR-8063	PAR-CLIP	27292025
MIRT475571	hsa-miR-183-3p	Luciferase reporter assay, RNA-seq	33474615
MIRT667945	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT667944	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT657347	hsa-miR-1-5p	HITS-CLIP	23824327
MIRT277852	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT657346	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT657345	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT667943	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT667942	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT657344	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT341160	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT341161	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT657343	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT657341	hsa-miR-6828-3p	HITS-CLIP	23824327
MIRT657342	hsa-miR-6071	HITS-CLIP	23824327
MIRT657340	hsa-miR-544a	HITS-CLIP	23824327
MIRT657339	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT657348	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT657347	hsa-miR-1-5p	HITS-CLIP	23824327
MIRT277852	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT657346	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT657345	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657344	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT341160	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT341161	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT657343	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT657341	hsa-miR-6828-3p	HITS-CLIP	23824327
MIRT657342	hsa-miR-6071	HITS-CLIP	23824327
MIRT657340	hsa-miR-544a	HITS-CLIP	23824327
MIRT657339	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT574679	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT574678	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT574677	hsa-miR-4531	PAR-CLIP	20371350
MIRT574676	hsa-miR-1270	PAR-CLIP	20371350
MIRT574675	hsa-miR-620	PAR-CLIP	20371350
MIRT574674	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT571998	hsa-miR-4773	PAR-CLIP	20371350
MIRT571997	hsa-miR-4699-5p	PAR-CLIP	20371350
MIRT511477	hsa-miR-3133	PAR-CLIP	20371350
MIRT511476	hsa-miR-4511	PAR-CLIP	20371350
MIRT511475	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT511474	hsa-miR-4539	PAR-CLIP	20371350
MIRT511473	hsa-miR-3924	PAR-CLIP	20371350
MIRT511477	hsa-miR-3133	PAR-CLIP	20371350
MIRT511476	hsa-miR-4511	PAR-CLIP	20371350
MIRT511475	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT511474	hsa-miR-4539	PAR-CLIP	20371350
MIRT511473	hsa-miR-3924	PAR-CLIP	20371350
MIRT557229	hsa-miR-3139	PAR-CLIP	21572407
MIRT557228	hsa-miR-28-5p	PAR-CLIP	21572407
MIRT557227	hsa-miR-708-5p	PAR-CLIP	21572407
MIRT557226	hsa-miR-606	PAR-CLIP	21572407
MIRT557225	hsa-miR-6503-3p	PAR-CLIP	21572407
MIRT557224	hsa-miR-3199	PAR-CLIP	21572407
MIRT557222	hsa-miR-8052	PAR-CLIP	21572407
MIRT557223	hsa-miR-365a-5p	PAR-CLIP	21572407
MIRT557221	hsa-miR-365b-5p	PAR-CLIP	21572407
MIRT511477	hsa-miR-3133	PAR-CLIP	23446348
MIRT511476	hsa-miR-4511	PAR-CLIP	23446348
MIRT511475	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT511474	hsa-miR-4539	PAR-CLIP	23446348
MIRT511473	hsa-miR-3924	PAR-CLIP	23446348
MIRT502268	hsa-miR-224-5p	PAR-CLIP	24398324
MIRT502267	hsa-miR-548e-5p	PAR-CLIP	24398324
MIRT502266	hsa-miR-4311	PAR-CLIP	24398324
MIRT502265	hsa-miR-1276	PAR-CLIP	24398324
MIRT502264	hsa-miR-583	PAR-CLIP	24398324
MIRT502263	hsa-miR-548p	PAR-CLIP	24398324
MIRT502262	hsa-miR-8063	PAR-CLIP	24398324
MIRT502261	hsa-miR-4698	PAR-CLIP	24398324
MIRT502260	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT475577	hsa-miR-4517	PAR-CLIP	23592263
MIRT475576	hsa-miR-5090	PAR-CLIP	23592263
MIRT475575	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT037494	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT475574	hsa-miR-4533	PAR-CLIP	23592263
MIRT475573	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT475572	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT475571	hsa-miR-183-3p	PAR-CLIP	23592263
MIRT756185	hsa-miR-944	Western blotting, qRT-PCR	34952600
MIRT1051255	hsa-let-7a	CLIP-seq
MIRT1051256	hsa-let-7b	CLIP-seq
MIRT1051257	hsa-let-7c	CLIP-seq
MIRT1051258	hsa-let-7d	CLIP-seq
MIRT1051259	hsa-let-7e	CLIP-seq
MIRT1051260	hsa-let-7f	CLIP-seq
MIRT1051261	hsa-let-7g	CLIP-seq
MIRT1051262	hsa-let-7i	CLIP-seq
MIRT1051263	hsa-miR-1255a	CLIP-seq
MIRT1051264	hsa-miR-1255b	CLIP-seq
MIRT1051265	hsa-miR-1273d	CLIP-seq
MIRT1051266	hsa-miR-141	CLIP-seq
MIRT1051267	hsa-miR-143	CLIP-seq
MIRT1051268	hsa-miR-144	CLIP-seq
MIRT1051269	hsa-miR-145	CLIP-seq
MIRT1051270	hsa-miR-186	CLIP-seq
MIRT1051271	hsa-miR-1913	CLIP-seq
MIRT1051272	hsa-miR-200a	CLIP-seq
MIRT1051273	hsa-miR-202	CLIP-seq
MIRT1051274	hsa-miR-208a	CLIP-seq
MIRT1051275	hsa-miR-208b	CLIP-seq
MIRT1051276	hsa-miR-224	CLIP-seq
MIRT1051277	hsa-miR-2277-5p	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT1051279	hsa-miR-3135	CLIP-seq
MIRT1051280	hsa-miR-3150a-3p	CLIP-seq
MIRT1051281	hsa-miR-3160-5p	CLIP-seq
MIRT1051282	hsa-miR-3175	CLIP-seq
MIRT1051283	hsa-miR-3189-5p	CLIP-seq
MIRT1051284	hsa-miR-320a	CLIP-seq
MIRT1051285	hsa-miR-320b	CLIP-seq
MIRT1051286	hsa-miR-320c	CLIP-seq
MIRT1051287	hsa-miR-320d	CLIP-seq
MIRT1051288	hsa-miR-324-3p	CLIP-seq
MIRT1051289	hsa-miR-330-3p	CLIP-seq
MIRT1051290	hsa-miR-335	CLIP-seq
MIRT1051291	hsa-miR-3545-3p	CLIP-seq
MIRT1051292	hsa-miR-3646	CLIP-seq
MIRT1051293	hsa-miR-3647-3p	CLIP-seq
MIRT1051294	hsa-miR-3668	CLIP-seq
MIRT1051295	hsa-miR-4263	CLIP-seq
MIRT1051296	hsa-miR-4282	CLIP-seq
MIRT1051297	hsa-miR-4286	CLIP-seq
MIRT1051298	hsa-miR-4299	CLIP-seq
MIRT1051299	hsa-miR-4301	CLIP-seq
MIRT1051300	hsa-miR-4429	CLIP-seq
MIRT1051301	hsa-miR-4456	CLIP-seq
MIRT1051302	hsa-miR-4458	CLIP-seq
MIRT1051303	hsa-miR-4500	CLIP-seq
MIRT1051304	hsa-miR-4506	CLIP-seq
MIRT1051305	hsa-miR-455-5p	CLIP-seq
MIRT1051306	hsa-miR-4719	CLIP-seq
MIRT1051307	hsa-miR-4732-5p	CLIP-seq
MIRT1051308	hsa-miR-4758-3p	CLIP-seq
MIRT1051309	hsa-miR-4770	CLIP-seq
MIRT1051310	hsa-miR-4799-5p	CLIP-seq
MIRT1051311	hsa-miR-495	CLIP-seq
MIRT1051312	hsa-miR-498	CLIP-seq
MIRT1051313	hsa-miR-499-5p	CLIP-seq
MIRT1051314	hsa-miR-548o	CLIP-seq
MIRT1051315	hsa-miR-548q	CLIP-seq
MIRT1051316	hsa-miR-554	CLIP-seq
MIRT1051317	hsa-miR-570	CLIP-seq
MIRT1051318	hsa-miR-576-5p	CLIP-seq
MIRT1051319	hsa-miR-599	CLIP-seq
MIRT1051320	hsa-miR-653	CLIP-seq
MIRT1051321	hsa-miR-664	CLIP-seq
MIRT1051322	hsa-miR-708	CLIP-seq
MIRT1051323	hsa-miR-744	CLIP-seq
MIRT1051324	hsa-miR-888	CLIP-seq
MIRT1051325	hsa-miR-889	CLIP-seq
MIRT1051326	hsa-miR-939	CLIP-seq
MIRT756185	hsa-miR-944	CLIP-seq
MIRT1051327	hsa-miR-98	CLIP-seq
MIRT1051255	hsa-let-7a	CLIP-seq
MIRT1051256	hsa-let-7b	CLIP-seq
MIRT1051257	hsa-let-7c	CLIP-seq
MIRT1051258	hsa-let-7d	CLIP-seq
MIRT1051259	hsa-let-7e	CLIP-seq
MIRT1051260	hsa-let-7f	CLIP-seq
MIRT1051261	hsa-let-7g	CLIP-seq
MIRT1051262	hsa-let-7i	CLIP-seq
MIRT1051328	hsa-miR-1243	CLIP-seq
MIRT1051263	hsa-miR-1255a	CLIP-seq
MIRT1051264	hsa-miR-1255b	CLIP-seq
MIRT1051266	hsa-miR-141	CLIP-seq
MIRT1051270	hsa-miR-186	CLIP-seq
MIRT1051272	hsa-miR-200a	CLIP-seq
MIRT1051273	hsa-miR-202	CLIP-seq
MIRT1051277	hsa-miR-2277-5p	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT1051279	hsa-miR-3135	CLIP-seq
MIRT1051280	hsa-miR-3150a-3p	CLIP-seq
MIRT1051282	hsa-miR-3175	CLIP-seq
MIRT1051293	hsa-miR-3647-3p	CLIP-seq
MIRT1051296	hsa-miR-4282	CLIP-seq
MIRT1051298	hsa-miR-4299	CLIP-seq
MIRT1051301	hsa-miR-4456	CLIP-seq
MIRT1051302	hsa-miR-4458	CLIP-seq
MIRT1051303	hsa-miR-4500	CLIP-seq
MIRT1051304	hsa-miR-4506	CLIP-seq
MIRT1051329	hsa-miR-4789-5p	CLIP-seq
MIRT1051311	hsa-miR-495	CLIP-seq
MIRT1051313	hsa-miR-499-5p	CLIP-seq
MIRT1051314	hsa-miR-548o	CLIP-seq
MIRT1051315	hsa-miR-548q	CLIP-seq
MIRT1051330	hsa-miR-600	CLIP-seq
MIRT1051321	hsa-miR-664	CLIP-seq
MIRT1051322	hsa-miR-708	CLIP-seq
MIRT1051323	hsa-miR-744	CLIP-seq
MIRT1051325	hsa-miR-889	CLIP-seq
MIRT1051326	hsa-miR-939	CLIP-seq
MIRT1051327	hsa-miR-98	CLIP-seq
MIRT1051296	hsa-miR-4282	CLIP-seq
MIRT1051298	hsa-miR-4299	CLIP-seq
MIRT1051301	hsa-miR-4456	CLIP-seq
MIRT1051315	hsa-miR-548q	CLIP-seq
MIRT1549584	hsa-miR-548ae	CLIP-seq
MIRT1549585	hsa-miR-548aj	CLIP-seq
MIRT1549586	hsa-miR-548am	CLIP-seq
MIRT1549587	hsa-miR-548x	CLIP-seq
MIRT1051269	hsa-miR-145	CLIP-seq
MIRT1922771	hsa-miR-194	CLIP-seq
MIRT1922772	hsa-miR-3117-5p	CLIP-seq
MIRT1922773	hsa-miR-4639-3p	CLIP-seq
MIRT1922774	hsa-miR-548n	CLIP-seq
MIRT1922775	hsa-miR-548t	CLIP-seq
MIRT1051316	hsa-miR-554	CLIP-seq
MIRT1051273	hsa-miR-202	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT1051266	hsa-miR-141	CLIP-seq
MIRT1051269	hsa-miR-145	CLIP-seq
MIRT1051270	hsa-miR-186	CLIP-seq
MIRT1922771	hsa-miR-194	CLIP-seq
MIRT1051272	hsa-miR-200a	CLIP-seq
MIRT1051273	hsa-miR-202	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT1922772	hsa-miR-3117-5p	CLIP-seq
MIRT2011740	hsa-miR-3121-5p	CLIP-seq
MIRT1051279	hsa-miR-3135	CLIP-seq
MIRT2011741	hsa-miR-3162-5p	CLIP-seq
MIRT1051293	hsa-miR-3647-3p	CLIP-seq
MIRT2011742	hsa-miR-3670	CLIP-seq
MIRT1051295	hsa-miR-4263	CLIP-seq
MIRT1051304	hsa-miR-4506	CLIP-seq
MIRT1922773	hsa-miR-4639-3p	CLIP-seq
MIRT1051310	hsa-miR-4799-5p	CLIP-seq
MIRT1051313	hsa-miR-499-5p	CLIP-seq
MIRT1922774	hsa-miR-548n	CLIP-seq
MIRT1922775	hsa-miR-548t	CLIP-seq
MIRT1051316	hsa-miR-554	CLIP-seq
MIRT2011743	hsa-miR-556-5p	CLIP-seq
MIRT1051317	hsa-miR-570	CLIP-seq
MIRT1051318	hsa-miR-576-5p	CLIP-seq
MIRT1051321	hsa-miR-664	CLIP-seq
MIRT2243955	hsa-miR-1202	CLIP-seq
MIRT2243956	hsa-miR-1207-3p	CLIP-seq
MIRT1051265	hsa-miR-1273d	CLIP-seq
MIRT2243957	hsa-miR-1294	CLIP-seq
MIRT1051266	hsa-miR-141	CLIP-seq
MIRT1051268	hsa-miR-144	CLIP-seq
MIRT1051269	hsa-miR-145	CLIP-seq
MIRT1051270	hsa-miR-186	CLIP-seq
MIRT2243958	hsa-miR-1909	CLIP-seq
MIRT1051271	hsa-miR-1913	CLIP-seq
MIRT1922771	hsa-miR-194	CLIP-seq
MIRT1051272	hsa-miR-200a	CLIP-seq
MIRT1051273	hsa-miR-202	CLIP-seq
MIRT1051274	hsa-miR-208a	CLIP-seq
MIRT1051275	hsa-miR-208b	CLIP-seq
MIRT1051276	hsa-miR-224	CLIP-seq
MIRT1051277	hsa-miR-2277-5p	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT2243959	hsa-miR-2682	CLIP-seq
MIRT2243960	hsa-miR-3074-3p	CLIP-seq
MIRT1922772	hsa-miR-3117-5p	CLIP-seq
MIRT2011740	hsa-miR-3121-5p	CLIP-seq
MIRT2243961	hsa-miR-3125	CLIP-seq
MIRT1051279	hsa-miR-3135	CLIP-seq
MIRT2243962	hsa-miR-3148	CLIP-seq
MIRT1051280	hsa-miR-3150a-3p	CLIP-seq
MIRT2243963	hsa-miR-3155	CLIP-seq
MIRT2243964	hsa-miR-3155b	CLIP-seq
MIRT1051281	hsa-miR-3160-5p	CLIP-seq
MIRT2011741	hsa-miR-3162-5p	CLIP-seq
MIRT1051282	hsa-miR-3175	CLIP-seq
MIRT1051283	hsa-miR-3189-5p	CLIP-seq
MIRT2243965	hsa-miR-3194-5p	CLIP-seq
MIRT1051288	hsa-miR-324-3p	CLIP-seq
MIRT1051289	hsa-miR-330-3p	CLIP-seq
MIRT1051290	hsa-miR-335	CLIP-seq
MIRT1051291	hsa-miR-3545-3p	CLIP-seq
MIRT2243966	hsa-miR-3605-5p	CLIP-seq
MIRT2243967	hsa-miR-3619-3p	CLIP-seq
MIRT2243968	hsa-miR-3622a-3p	CLIP-seq
MIRT2243969	hsa-miR-3622b-3p	CLIP-seq
MIRT1051293	hsa-miR-3647-3p	CLIP-seq
MIRT2243970	hsa-miR-3660	CLIP-seq
MIRT2243971	hsa-miR-3714	CLIP-seq
MIRT2243972	hsa-miR-3916	CLIP-seq
MIRT2243973	hsa-miR-3972	CLIP-seq
MIRT1051296	hsa-miR-4282	CLIP-seq
MIRT1051298	hsa-miR-4299	CLIP-seq
MIRT2243974	hsa-miR-4316	CLIP-seq
MIRT1051301	hsa-miR-4456	CLIP-seq
MIRT2243975	hsa-miR-449c	CLIP-seq
MIRT1051304	hsa-miR-4506	CLIP-seq
MIRT2243976	hsa-miR-4526	CLIP-seq
MIRT1922773	hsa-miR-4639-3p	CLIP-seq
MIRT2243977	hsa-miR-4646-5p	CLIP-seq
MIRT2243978	hsa-miR-4687-3p	CLIP-seq
MIRT2243979	hsa-miR-4705	CLIP-seq
MIRT1051306	hsa-miR-4719	CLIP-seq
MIRT2243980	hsa-miR-4728-3p	CLIP-seq
MIRT2243981	hsa-miR-4735-5p	CLIP-seq
MIRT2243982	hsa-miR-4752	CLIP-seq
MIRT1051308	hsa-miR-4758-3p	CLIP-seq
MIRT2243983	hsa-miR-4762-5p	CLIP-seq
MIRT2243984	hsa-miR-4776-5p	CLIP-seq
MIRT2243985	hsa-miR-4777-5p	CLIP-seq
MIRT1051329	hsa-miR-4789-5p	CLIP-seq
MIRT2243986	hsa-miR-489	CLIP-seq
MIRT2243987	hsa-miR-494	CLIP-seq
MIRT1051311	hsa-miR-495	CLIP-seq
MIRT1051312	hsa-miR-498	CLIP-seq
MIRT1051313	hsa-miR-499-5p	CLIP-seq
MIRT2243988	hsa-miR-501-5p	CLIP-seq
MIRT2243989	hsa-miR-513b	CLIP-seq
MIRT2243990	hsa-miR-514	CLIP-seq
MIRT2243991	hsa-miR-514b-3p	CLIP-seq
MIRT2243992	hsa-miR-518d-5p	CLIP-seq
MIRT2243993	hsa-miR-519b-5p	CLIP-seq
MIRT2243994	hsa-miR-519c-5p	CLIP-seq
MIRT2243995	hsa-miR-520c-5p	CLIP-seq
MIRT2243996	hsa-miR-526a	CLIP-seq
MIRT2243997	hsa-miR-544	CLIP-seq
MIRT1549584	hsa-miR-548ae	CLIP-seq
MIRT1549585	hsa-miR-548aj	CLIP-seq
MIRT1549586	hsa-miR-548am	CLIP-seq
MIRT1922774	hsa-miR-548n	CLIP-seq
MIRT1051314	hsa-miR-548o	CLIP-seq
MIRT1051315	hsa-miR-548q	CLIP-seq
MIRT1549587	hsa-miR-548x	CLIP-seq
MIRT1051316	hsa-miR-554	CLIP-seq
MIRT1051317	hsa-miR-570	CLIP-seq
MIRT2243998	hsa-miR-586	CLIP-seq
MIRT1051319	hsa-miR-599	CLIP-seq
MIRT1051320	hsa-miR-653	CLIP-seq
MIRT1051321	hsa-miR-664	CLIP-seq
MIRT1051322	hsa-miR-708	CLIP-seq
MIRT1051323	hsa-miR-744	CLIP-seq
MIRT2243999	hsa-miR-877	CLIP-seq
MIRT1051324	hsa-miR-888	CLIP-seq
MIRT1051326	hsa-miR-939	CLIP-seq
MIRT756185	hsa-miR-944	CLIP-seq
MIRT1051269	hsa-miR-145	CLIP-seq
MIRT1922771	hsa-miR-194	CLIP-seq
MIRT1051277	hsa-miR-2277-5p	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT1922772	hsa-miR-3117-5p	CLIP-seq
MIRT1051280	hsa-miR-3150a-3p	CLIP-seq
MIRT1051282	hsa-miR-3175	CLIP-seq
MIRT1051293	hsa-miR-3647-3p	CLIP-seq
MIRT1922773	hsa-miR-4639-3p	CLIP-seq
MIRT1922774	hsa-miR-548n	CLIP-seq
MIRT1922775	hsa-miR-548t	CLIP-seq
MIRT1051316	hsa-miR-554	CLIP-seq
MIRT1051322	hsa-miR-708	CLIP-seq
MIRT1051323	hsa-miR-744	CLIP-seq
MIRT1051326	hsa-miR-939	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT1051280	hsa-miR-3150a-3p	CLIP-seq
MIRT1051282	hsa-miR-3175	CLIP-seq
MIRT1051306	hsa-miR-4719	CLIP-seq
MIRT2243989	hsa-miR-513b	CLIP-seq
MIRT1051326	hsa-miR-939	CLIP-seq
MIRT2243957	hsa-miR-1294	CLIP-seq
MIRT2547028	hsa-miR-130a	CLIP-seq
MIRT2547029	hsa-miR-130b	CLIP-seq
MIRT1051269	hsa-miR-145	CLIP-seq
MIRT1922771	hsa-miR-194	CLIP-seq
MIRT2547030	hsa-miR-2113	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT2547031	hsa-miR-301a	CLIP-seq
MIRT2547032	hsa-miR-301b	CLIP-seq
MIRT1922772	hsa-miR-3117-5p	CLIP-seq
MIRT2011740	hsa-miR-3121-5p	CLIP-seq
MIRT2547033	hsa-miR-3145-5p	CLIP-seq
MIRT1051280	hsa-miR-3150a-3p	CLIP-seq
MIRT1051281	hsa-miR-3160-5p	CLIP-seq
MIRT2547034	hsa-miR-3161	CLIP-seq
MIRT2011741	hsa-miR-3162-5p	CLIP-seq
MIRT1051282	hsa-miR-3175	CLIP-seq
MIRT1051284	hsa-miR-320a	CLIP-seq
MIRT1051285	hsa-miR-320b	CLIP-seq
MIRT1051286	hsa-miR-320c	CLIP-seq
MIRT1051287	hsa-miR-320d	CLIP-seq
MIRT1051289	hsa-miR-330-3p	CLIP-seq
MIRT1051290	hsa-miR-335	CLIP-seq
MIRT2547035	hsa-miR-3607-3p	CLIP-seq
MIRT1051292	hsa-miR-3646	CLIP-seq
MIRT1051293	hsa-miR-3647-3p	CLIP-seq
MIRT2547036	hsa-miR-3666	CLIP-seq
MIRT2011742	hsa-miR-3670	CLIP-seq
MIRT2547037	hsa-miR-3682-5p	CLIP-seq
MIRT2547038	hsa-miR-4295	CLIP-seq
MIRT2243974	hsa-miR-4316	CLIP-seq
MIRT1051300	hsa-miR-4429	CLIP-seq
MIRT2547039	hsa-miR-454	CLIP-seq
MIRT1922773	hsa-miR-4639-3p	CLIP-seq
MIRT2547040	hsa-miR-4671-3p	CLIP-seq
MIRT1051306	hsa-miR-4719	CLIP-seq
MIRT2243982	hsa-miR-4752	CLIP-seq
MIRT2243985	hsa-miR-4777-5p	CLIP-seq
MIRT2547041	hsa-miR-4789-3p	CLIP-seq
MIRT1051312	hsa-miR-498	CLIP-seq
MIRT2243989	hsa-miR-513b	CLIP-seq
MIRT2243992	hsa-miR-518d-5p	CLIP-seq
MIRT2243993	hsa-miR-519b-5p	CLIP-seq
MIRT2243994	hsa-miR-519c-5p	CLIP-seq
MIRT2243995	hsa-miR-520c-5p	CLIP-seq
MIRT2243996	hsa-miR-526a	CLIP-seq
MIRT1922774	hsa-miR-548n	CLIP-seq
MIRT1922775	hsa-miR-548t	CLIP-seq
MIRT1051316	hsa-miR-554	CLIP-seq
MIRT2011743	hsa-miR-556-5p	CLIP-seq
MIRT2547042	hsa-miR-561	CLIP-seq
MIRT1051322	hsa-miR-708	CLIP-seq
MIRT2547043	hsa-miR-765	CLIP-seq
MIRT1051324	hsa-miR-888	CLIP-seq
MIRT1051326	hsa-miR-939	CLIP-seq
MIRT2243957	hsa-miR-1294	CLIP-seq
MIRT2547028	hsa-miR-130a	CLIP-seq
MIRT2547029	hsa-miR-130b	CLIP-seq
MIRT1051269	hsa-miR-145	CLIP-seq
MIRT2682377	hsa-miR-147	CLIP-seq
MIRT1922771	hsa-miR-194	CLIP-seq
MIRT2547030	hsa-miR-2113	CLIP-seq
MIRT1051277	hsa-miR-2277-5p	CLIP-seq
MIRT1051278	hsa-miR-2392	CLIP-seq
MIRT2547031	hsa-miR-301a	CLIP-seq
MIRT2547032	hsa-miR-301b	CLIP-seq
MIRT1922772	hsa-miR-3117-5p	CLIP-seq
MIRT2011740	hsa-miR-3121-5p	CLIP-seq
MIRT2547033	hsa-miR-3145-5p	CLIP-seq
MIRT1051280	hsa-miR-3150a-3p	CLIP-seq
MIRT1051281	hsa-miR-3160-5p	CLIP-seq
MIRT2011741	hsa-miR-3162-5p	CLIP-seq
MIRT2682378	hsa-miR-3163	CLIP-seq
MIRT1051282	hsa-miR-3175	CLIP-seq
MIRT1051284	hsa-miR-320a	CLIP-seq
MIRT1051285	hsa-miR-320b	CLIP-seq
MIRT1051286	hsa-miR-320c	CLIP-seq
MIRT1051287	hsa-miR-320d	CLIP-seq
MIRT1051289	hsa-miR-330-3p	CLIP-seq
MIRT1051290	hsa-miR-335	CLIP-seq
MIRT2243968	hsa-miR-3622a-3p	CLIP-seq
MIRT2243969	hsa-miR-3622b-3p	CLIP-seq
MIRT1051292	hsa-miR-3646	CLIP-seq
MIRT1051293	hsa-miR-3647-3p	CLIP-seq
MIRT2682379	hsa-miR-3662	CLIP-seq
MIRT2547036	hsa-miR-3666	CLIP-seq
MIRT2011742	hsa-miR-3670	CLIP-seq
MIRT2547037	hsa-miR-3682-5p	CLIP-seq
MIRT2547038	hsa-miR-4295	CLIP-seq
MIRT1051298	hsa-miR-4299	CLIP-seq
MIRT2243974	hsa-miR-4316	CLIP-seq
MIRT1051300	hsa-miR-4429	CLIP-seq
MIRT1051301	hsa-miR-4456	CLIP-seq
MIRT2682380	hsa-miR-4464	CLIP-seq
MIRT2547039	hsa-miR-454	CLIP-seq
MIRT1922773	hsa-miR-4639-3p	CLIP-seq
MIRT2682381	hsa-miR-4668-3p	CLIP-seq
MIRT2547040	hsa-miR-4671-3p	CLIP-seq
MIRT1051306	hsa-miR-4719	CLIP-seq
MIRT2682382	hsa-miR-4748	CLIP-seq
MIRT2243982	hsa-miR-4752	CLIP-seq
MIRT2243985	hsa-miR-4777-5p	CLIP-seq
MIRT2547041	hsa-miR-4789-3p	CLIP-seq
MIRT2243987	hsa-miR-494	CLIP-seq
MIRT1051311	hsa-miR-495	CLIP-seq
MIRT1051312	hsa-miR-498	CLIP-seq
MIRT1051313	hsa-miR-499-5p	CLIP-seq
MIRT2243989	hsa-miR-513b	CLIP-seq
MIRT2243992	hsa-miR-518d-5p	CLIP-seq
MIRT2243993	hsa-miR-519b-5p	CLIP-seq
MIRT2243994	hsa-miR-519c-5p	CLIP-seq
MIRT2243995	hsa-miR-520c-5p	CLIP-seq
MIRT2243996	hsa-miR-526a	CLIP-seq
MIRT1922774	hsa-miR-548n	CLIP-seq
MIRT1051314	hsa-miR-548o	CLIP-seq
MIRT1051315	hsa-miR-548q	CLIP-seq
MIRT1922775	hsa-miR-548t	CLIP-seq
MIRT1051316	hsa-miR-554	CLIP-seq
MIRT2011743	hsa-miR-556-5p	CLIP-seq
MIRT1051319	hsa-miR-599	CLIP-seq
MIRT1051322	hsa-miR-708	CLIP-seq
MIRT1051323	hsa-miR-744	CLIP-seq
MIRT2547043	hsa-miR-765	CLIP-seq
MIRT1051324	hsa-miR-888	CLIP-seq
MIRT2682383	hsa-miR-891b	CLIP-seq
MIRT1051326	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	IC	9731529, 11991638
GO:0000398	Process	MRNA splicing, via spliceosome	IMP	25719671
GO:0000785	Component	Chromatin	HDA	16217013
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	IPI	18082603
GO:0003723	Function	RNA binding	NAS	9731529
GO:0003730	Function	MRNA 3'-UTR binding	IDA	16010978
GO:0005515	Function	Protein binding	IPI	11546873, 11687588, 15034300, 15161933, 16189514, 17289661, 17500595, 19447967, 20467437, 20618440, 21516116, 21653829, 21988832, 22365833, 22446626, 22720776, 23602568, 24965446, 24981860, 25416956, 25678563, 30021884, 32296183, 32814053, 33961781, 35044719, 35271311, 39251607
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11687588, 22720776
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IDA	9731529
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005697	Component	Telomerase holoenzyme complex	IDA	18082603
GO:0005829	Component	Cytosol	IDA	16010978
GO:0006338	Process	Chromatin remodeling	HDA	16217013
GO:0006397	Process	MRNA processing	IEA
GO:0008266	Function	Poly(U) RNA binding	IDA	16010978
GO:0008380	Process	RNA splicing	IEA
GO:0008380	Process	RNA splicing	TAS	3110598
GO:0015629	Component	Actin cytoskeleton	IDA	11687588
GO:0016020	Component	Membrane	HDA	16210410
GO:0031492	Function	Nucleosomal DNA binding	HDA	16217013
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IMP	18082603
GO:0032991	Component	Protein-containing complex	HDA	16217013
GO:0032991	Component	Protein-containing complex	IDA	11687588
GO:0042802	Function	Identical protein binding	IPI	16189514, 21516116, 22365833, 25416956, 32296183
GO:0070034	Function	Telomerase RNA binding	IPI	18082603
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IMP	16010978
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IDA	25719671
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 164020
• HGNC: 5035
• e!Ensembl: ENSG00000092199

Protein

• UniProt ID: P07910
• Protein name: Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1/C2)
• Protein function: Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles (PubMed:8264621). Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules (PubMed:12509468, Pu
• PDB: 1TXP, 1WF2, 2MXY, 2MZ1, 3LN4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	18 → 81	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Sequence:

  MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNE
  RNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSS
  SFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQR
  GSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSS
  SVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSA
  NGEDDS

• Sequence length: 306

Pathways

KEGG:

Spliceosome

Reactome:

SUMOylation of RNA binding proteins
mRNA Splicing - Major Pathway
Processing of Capped Intron-Containing Pre-mRNA

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Intellectual developmental disorder, autosomal dominant 74	Pathogenic	rs2501840293, rs1284488942	RCV003493378 RCV003493833	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASDB_DG	19836008		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33725886	Inhibit	★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33952721	Associate	★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	1090155		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	CTD_human_DG	3501473		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	16518403, 17576744, 18806293, 18806297, 19696172, 22232432, 24453474, 29801032		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	CTD_human_DG	16518403		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	17576744, 18806297		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	GWASDB_DG	20385819, 21665990, 22694956, 22705344, 23577725		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	GWASCAT_DG	20385819, 21665990		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	9114023	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25616961, 29131108, 29867335		★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	2934317, 6222104		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28774272	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	1445220		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	1445220	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18508286	Stimulate	★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	34899688	Associate	★☆☆☆☆ Found in Text Mining only
Auditory neuropathy	Auditory neuropathy	Pubtator	15637703	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	2582254		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29947342, 36858027	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	29947342	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	32915499	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26367347, 26824423, 30158112		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23585894	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25913416, 30389667, 32915777, 34952600	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32526707, 35355828	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10964780, 27565572, 32626741, 32631107, 34221187, 35848884, 35963644, 37469973	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39735682	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11506822, 12012004, 12871776, 17973258, 18461365, 23511627, 31317334		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35355828	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33177247, 38184608	Associate	★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	19430225	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26824423, 31823961		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31823961	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28079881, 30987669, 31819776		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31147722, 31823961	Associate	★☆☆☆☆ Found in Text Mining only
COMPLEMENT COMPONENT 2 DEFICIENCY	Complement Component Deficiency	BEFREE	1090155, 1577763, 20727163, 2582254, 315933, 7932427, 965492		★☆☆☆☆ Found in Text Mining only
COMPLEMENT COMPONENT 2 DEFICIENCY	Complement Component Deficiency	CLINVAR_DG	1577763		★☆☆☆☆ Found in Text Mining only
COMPLEMENT COMPONENT 2 DEFICIENCY	Complement Component Deficiency	GENOMICS_ENGLAND_DG	7901282		★☆☆☆☆ Found in Text Mining only
COMPLEMENT COMPONENT 2 DEFICIENCY	Complement Component Deficiency	UNIPROT_DG	8621452, 9670930		★☆☆☆☆ Found in Text Mining only
COMPLEMENT COMPONENT 2 DEFICIENCY	Complement Component Deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	BEFREE	20727163, 2582254, 8645999		★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	GENOMICS_ENGLAND_DG	7901282		★☆☆☆☆ Found in Text Mining only
Complement Factor H Deficiency	Complement component deficiency	Pubtator	34899688	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	22610944		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	28714975, 29212778, 30104761		★☆☆☆☆ Found in Text Mining only
Cytochrome c Oxidase Deficiency	Cytochrome c oxidase deficiency	Pubtator	9114023	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	26926881	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Irritant	Dermatitis	CTD_human_DG	27258892		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	1090155		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	CTD_human_DG	3501473		★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	CTD_human_DG	3501473		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32641735	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	7464619		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36891946	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35731272	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	GWASCAT_DG	28881265		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	33232273, 36672827	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26934124	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26934124, 34054840, 37417427	Associate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	GWASCAT_DG	22705344		★☆☆☆☆ Found in Text Mining only
exudative macular degeneration	Exudative macular degeneration	GWASCAT_DG	22705344		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	29867335		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	35794744	Associate	★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	GWASCAT_DG	22705344		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22907752, 35558067, 39216042	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31283707		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31283707		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10441480		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35832652	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	34380091	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	6893039		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	29357978	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	18508286	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	10441480		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29301248		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	29301248	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	25133636		★☆☆☆☆ Found in Text Mining only
Immunodeficiency due to a classical component pathway complement deficiency	Immunodeficiency	Orphanet			★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	965492		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34899688	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34380091	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17627933, 24572810, 27565572, 28260918, 6088497		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	GWASDB_DG	23242368		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	6088497		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	39735682	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31405929		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	GENOMICS_ENGLAND_DG	7901282		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15248220	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	1084239, 31405929, 315933		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	GENOMICS_ENGLAND_DG	6902670, 7901282		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12509629, 26176736, 31405929, 6797295, 7932427, 8305927, 8843857, 965492		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	24871463		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GENOMICS_ENGLAND_DG	7901282		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31405929		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	GENOMICS_ENGLAND_DG	7901282		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	16518403, 19169411, 20157618, 20378180, 21139680, 22694956, 22933840, 23112567, 24453474, 24965207, 26961928, 27090374, 28774272	Associate	★☆☆☆☆ Found in Text Mining only
MACULAR DEGENERATION, AGE-RELATED, 14	Age-Related Macular Degeneration	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26367347, 26824423, 30158112		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24572810		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11506822, 12012004, 12871776, 17973258, 18461365, 23511627, 31317334		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	GWASDB_DG	18978787, 22899653		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17219427		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26553749		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31527303		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11506822, 17219427, 20010808, 20972326, 20978194, 23511627, 24516048, 25644089, 28315432		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26824423, 31823961		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	2582254		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15596045	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	31698554		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	9114023		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	32641735	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34219465	Associate	★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	15248220	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36177774	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	17660530		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	19628962	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	GWASDB_DG	23055271		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	23410585		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	11433021		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12579305, 17067748, 20190808, 24246049, 24572810, 26824423, 28079881, 28737690, 28766939, 30158112, 31819776		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21684615		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32176634	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17067748, 20972326		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37217897	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36967763	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28936921, 29899543	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35277915, 35355828	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	35355828	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	36418856	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26553749		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36718950	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	37108355	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1657009, 8843857, 965492		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088, 21156761		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21684615		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	28540026		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30824187		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16819278, 32526707, 36416324, 38458543	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31720080		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31527303		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	31482734	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26453116	Associate	★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	34965173	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35417090	Associate	★☆☆☆☆ Found in Text Mining only