Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	317749
Gene name	Dehydrogenase/reductase 4 like 2
Gene symbol	DHRS4L2
Synonyms (NCBI Gene)	SDR25C3
Chromosome	14
Chromosome location	14q11.2
Summary	This gene encodes a member of the short chain dehydrogenase reductase family. The encoded protein may be an NADPH dependent retinol oxidoreductase. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010]

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments
MIRT934983	hsa-miR-28-5p	CLIP-seq
MIRT934984	hsa-miR-3139	CLIP-seq
MIRT934985	hsa-miR-4633-3p	CLIP-seq
MIRT934986	hsa-miR-4733-3p	CLIP-seq
MIRT934987	hsa-miR-665	CLIP-seq
MIRT934988	hsa-miR-708	CLIP-seq
MIRT934989	hsa-miR-330-3p	CLIP-seq
MIRT934990	hsa-miR-4320	CLIP-seq
MIRT934991	hsa-miR-1587	CLIP-seq
MIRT934992	hsa-miR-3176	CLIP-seq
MIRT934993	hsa-miR-3922-3p	CLIP-seq
MIRT934994	hsa-miR-4265	CLIP-seq
MIRT934995	hsa-miR-4296	CLIP-seq
MIRT934996	hsa-miR-4322	CLIP-seq
MIRT934997	hsa-miR-4417	CLIP-seq
MIRT934998	hsa-miR-4492	CLIP-seq
MIRT934999	hsa-miR-4498	CLIP-seq
MIRT935000	hsa-miR-4656	CLIP-seq
MIRT935001	hsa-miR-4675	CLIP-seq
MIRT935002	hsa-miR-4741	CLIP-seq
MIRT935003	hsa-miR-4783-3p	CLIP-seq
MIRT935004	hsa-miR-626	CLIP-seq
MIRT935005	hsa-miR-762	CLIP-seq
MIRT1976862	hsa-miR-1202	CLIP-seq
MIRT1976863	hsa-miR-1207-5p	CLIP-seq
MIRT1976864	hsa-miR-1287	CLIP-seq
MIRT1976865	hsa-miR-27a	CLIP-seq
MIRT1976866	hsa-miR-27b	CLIP-seq
MIRT1976867	hsa-miR-3171	CLIP-seq
MIRT1976868	hsa-miR-3194-5p	CLIP-seq
MIRT1976869	hsa-miR-3652	CLIP-seq
MIRT1976870	hsa-miR-3667-3p	CLIP-seq
MIRT1976871	hsa-miR-3972	CLIP-seq
MIRT1976872	hsa-miR-4268	CLIP-seq
MIRT1976873	hsa-miR-4430	CLIP-seq
MIRT1976874	hsa-miR-4436b-3p	CLIP-seq
MIRT1976875	hsa-miR-4436b-5p	CLIP-seq
MIRT1976876	hsa-miR-4448	CLIP-seq
MIRT1976877	hsa-miR-4642	CLIP-seq
MIRT1976878	hsa-miR-4720-5p	CLIP-seq
MIRT1976879	hsa-miR-4747-5p	CLIP-seq
MIRT1976880	hsa-miR-4763-3p	CLIP-seq
MIRT1976881	hsa-miR-4799-3p	CLIP-seq
MIRT1976882	hsa-miR-5096	CLIP-seq
MIRT1976883	hsa-miR-513a-5p	CLIP-seq
MIRT1976884	hsa-miR-767-3p	CLIP-seq
MIRT1976885	hsa-miR-891b	CLIP-seq
MIRT1976862	hsa-miR-1202	CLIP-seq
MIRT2212153	hsa-miR-1208	CLIP-seq
MIRT2212154	hsa-miR-1248	CLIP-seq
MIRT2212155	hsa-miR-150	CLIP-seq
MIRT2212156	hsa-miR-208a	CLIP-seq
MIRT2212157	hsa-miR-208b	CLIP-seq
MIRT2212158	hsa-miR-214	CLIP-seq
MIRT2212159	hsa-miR-2355-5p	CLIP-seq
MIRT1976867	hsa-miR-3171	CLIP-seq
MIRT1976868	hsa-miR-3194-5p	CLIP-seq
MIRT2212160	hsa-miR-3619-5p	CLIP-seq
MIRT2212161	hsa-miR-3679-3p	CLIP-seq
MIRT1976871	hsa-miR-3972	CLIP-seq
MIRT2212162	hsa-miR-452	CLIP-seq
MIRT1976877	hsa-miR-4642	CLIP-seq
MIRT2212163	hsa-miR-4676-3p	CLIP-seq
MIRT2212164	hsa-miR-4713-5p	CLIP-seq
MIRT1976878	hsa-miR-4720-5p	CLIP-seq
MIRT2212165	hsa-miR-4740-3p	CLIP-seq
MIRT2212166	hsa-miR-4753-5p	CLIP-seq
MIRT2212167	hsa-miR-4768-5p	CLIP-seq
MIRT1976881	hsa-miR-4799-3p	CLIP-seq
MIRT2212168	hsa-miR-532-3p	CLIP-seq
MIRT2212169	hsa-miR-761	CLIP-seq
MIRT2212170	hsa-miR-942	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IBA
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005777	Component	Peroxisome	IBA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042574	Process	Retinal metabolic process	IBA

MIM	HGNC	e!Ensembl
615196	19731	ENSG00000187630

Q6PKH6

Protein name

Dehydrogenase/reductase SDR family member 4-like 2 (EC 1.1.-.-) (Short chain dehydrogenase/reductase family 25C member 3) (Protein SDR25C3)

Protein function

Probable oxidoreductase.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00106	adh_short	31 → 213	short chain dehydrogenase	Domain

Sequence

MARLLGLCAWARKSVRLASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVS
SRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPF
FGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPY
NVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA

Sequence length

230

Interactions

View interactions

	KEGG
	Retinol metabolism Metabolic pathways

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	31664702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DHRS4L2 (dehydrogenase/reductase 4 like 2)