ONECUT1 (one cut homeobox 1)

Gene

• Entrez ID: 3175
• Gene name: One cut homeobox 1
• Gene symbol: ONECUT1
• Synonyms (NCBI Gene): HNF-6, HNF6, HNF6A
• Chromosome: 15
• Chromosome location: 15q21.3
• Summary: This gene encodes a member of the Cut homeobox family of transcription factors. Expression of the encoded protein is enriched in the liver, where it stimulates transcription of liver-expressed genes, and antagonizes glucocorticoid-stimulated gene transcri

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT655629	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT655628	hsa-miR-3913-3p	HITS-CLIP	23824327
MIRT655627	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT655626	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT655625	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT655624	hsa-miR-1200	HITS-CLIP	23824327
MIRT655623	hsa-miR-489-3p	HITS-CLIP	23824327
MIRT655622	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT448637	hsa-miR-138-2-3p	PAR-CLIP	22100165
MIRT448636	hsa-miR-4635	PAR-CLIP	22100165
MIRT448635	hsa-miR-7515	PAR-CLIP	22100165
MIRT448634	hsa-miR-3179	PAR-CLIP	22100165
MIRT448633	hsa-miR-6126	PAR-CLIP	22100165
MIRT448632	hsa-miR-6864-5p	PAR-CLIP	22100165
MIRT448631	hsa-miR-4482-3p	PAR-CLIP	22100165
MIRT655629	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT655628	hsa-miR-3913-3p	HITS-CLIP	23824327
MIRT655627	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT655626	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT655625	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT655624	hsa-miR-1200	HITS-CLIP	23824327
MIRT655623	hsa-miR-489-3p	HITS-CLIP	23824327
MIRT655622	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT448637	hsa-miR-138-2-3p	PAR-CLIP	22100165
MIRT448636	hsa-miR-4635	PAR-CLIP	22100165
MIRT448635	hsa-miR-7515	PAR-CLIP	22100165
MIRT448634	hsa-miR-3179	PAR-CLIP	22100165
MIRT448633	hsa-miR-6126	PAR-CLIP	22100165
MIRT448632	hsa-miR-6864-5p	PAR-CLIP	22100165
MIRT448631	hsa-miR-4482-3p	PAR-CLIP	22100165
MIRT2286907	hsa-miR-1193	CLIP-seq
MIRT2286908	hsa-miR-2392	CLIP-seq
MIRT2286909	hsa-miR-3605-5p	CLIP-seq
MIRT2465765	hsa-miR-3671	CLIP-seq
MIRT2465766	hsa-miR-4263	CLIP-seq
MIRT2465767	hsa-miR-4659a-3p	CLIP-seq
MIRT2465768	hsa-miR-4659b-3p	CLIP-seq
MIRT2465769	hsa-miR-576-5p	CLIP-seq
MIRT2465770	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001889	Process	Liver development	IEA
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0002064	Process	Epithelial cell development	IEA
GO:0003309	Process	Type B pancreatic cell differentiation	IEA
GO:0003310	Process	Pancreatic A cell differentiation	IEA
GO:0003311	Process	Pancreatic D cell differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	10491763
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007492	Process	Endoderm development	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0031016	Process	Pancreas development	IEA
GO:0031018	Process	Endocrine pancreas development	IEA
GO:0035883	Process	Enteroendocrine cell differentiation	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048536	Process	Spleen development	IEA
GO:0060271	Process	Cilium assembly	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 604164
• HGNC: 8138
• e!Ensembl: ENSG00000169856

Protein

• UniProt ID: Q9UBC0
• Protein name: Hepatocyte nuclear factor 6 (HNF-6) (One cut domain family member 1) (One cut homeobox 1)
• Protein function: Transcriptional activator. Binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. Important for liver genes transcription.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02376	CUT	288 → 366	CUT domain	Domain
  PF00046	Homeodomain	386 → 440	Homeodomain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in liver; lower expression in testis and skin.
• Sequence:

  MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPRSMGMASLLD
  GGSGGGDYHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSD
  KFPHHHHHHHHHHHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLS
  PLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAG
  MVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR
  ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQ
  RMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ
  QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA

• Sequence length: 465

Pathways

KEGG:

Signaling pathways regulating pluripotency of stem cells
Maturity onset diabetes of the young

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Autosomal dominant polycystic liver disease	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEONATAL DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplasia	Anaplasia	BEFREE	26338995		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24638272		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	29388792		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24022481		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26825606		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	21893194		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20967225		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20967225	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30256389		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	29388792		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	26825606		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11323086		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34663987	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34663987	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10491763, 11323086		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	24638272		★☆☆☆☆ Found in Text Mining only
Gallbladder Agenesis Of	Gallbladder agenesis	Pubtator	34663987	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	29328431	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12509444, 26338995		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12509444		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24022481		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24638272		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20967225		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	11323086		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24798046, 26825606, 30256389		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24638272		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18097590		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34663987	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18398837		★☆☆☆☆ Found in Text Mining only