Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3169
Gene name	Forkhead box A1
Gene symbol	FOXA1
Synonyms (NCBI Gene)	HNF3ATCF3A
Chromosome	14
Chromosome location	14q21.1
Summary	This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar fami

580

Show/Hide all (580)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002078	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT002078	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT002078	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT002078	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT024644	hsa-miR-215-5p	Microarray	19074876
MIRT026509	hsa-miR-192-5p	Microarray	19074876
MIRT548195	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT548194	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT548193	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT548192	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT548191	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT548190	hsa-miR-218-2-3p	PAR-CLIP	21572407
MIRT548189	hsa-miR-758-5p	PAR-CLIP	21572407
MIRT548187	hsa-miR-496	PAR-CLIP	21572407
MIRT548186	hsa-miR-584-5p	PAR-CLIP	21572407
MIRT548185	hsa-miR-3064-3p	PAR-CLIP	21572407
MIRT548184	hsa-miR-4715-3p	PAR-CLIP	21572407
MIRT548195	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT548194	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT548193	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT548192	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT548191	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT548190	hsa-miR-218-2-3p	PAR-CLIP	21572407
MIRT548189	hsa-miR-758-5p	PAR-CLIP	21572407
MIRT548188	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT548187	hsa-miR-496	PAR-CLIP	21572407
MIRT548186	hsa-miR-584-5p	PAR-CLIP	21572407
MIRT548185	hsa-miR-3064-3p	PAR-CLIP	21572407
MIRT548184	hsa-miR-4715-3p	PAR-CLIP	21572407
MIRT548190	hsa-miR-218-2-3p	PAR-CLIP	27292025
MIRT548190	hsa-miR-218-2-3p	PAR-CLIP	27292025
MIRT548185	hsa-miR-3064-3p	PAR-CLIP	27292025
MIRT548185	hsa-miR-3064-3p	PAR-CLIP	27292025
MIRT548194	hsa-miR-30a-5p	PAR-CLIP	27292025
MIRT548194	hsa-miR-30a-5p	PAR-CLIP	27292025
MIRT548193	hsa-miR-30b-5p	PAR-CLIP	27292025
MIRT548193	hsa-miR-30b-5p	PAR-CLIP	27292025
MIRT548192	hsa-miR-30c-5p	PAR-CLIP	27292025
MIRT548192	hsa-miR-30c-5p	PAR-CLIP	27292025
MIRT548191	hsa-miR-30d-5p	PAR-CLIP	27292025
MIRT548191	hsa-miR-30d-5p	PAR-CLIP	27292025
MIRT548195	hsa-miR-30e-5p	PAR-CLIP	27292025
MIRT548195	hsa-miR-30e-5p	PAR-CLIP	27292025
MIRT548188	hsa-miR-3607-3p	PAR-CLIP	27292025
MIRT548184	hsa-miR-4715-3p	PAR-CLIP	27292025
MIRT548184	hsa-miR-4715-3p	PAR-CLIP	27292025
MIRT548187	hsa-miR-496	PAR-CLIP	27292025
MIRT548187	hsa-miR-496	PAR-CLIP	27292025
MIRT548186	hsa-miR-584-5p	PAR-CLIP	27292025
MIRT548186	hsa-miR-584-5p	PAR-CLIP	27292025
MIRT548189	hsa-miR-758-5p	PAR-CLIP	27292025
MIRT548189	hsa-miR-758-5p	PAR-CLIP	27292025
MIRT737378	hsa-miR-100-5p	Luciferase reporter assayWestern blotting	32201519
MIRT737379	hsa-miR-125b-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	32201519
MIRT548195	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT548194	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT548193	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT548192	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT548191	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT548190	hsa-miR-218-2-3p	PAR-CLIP	21572407
MIRT548189	hsa-miR-758-5p	PAR-CLIP	21572407
MIRT548187	hsa-miR-496	PAR-CLIP	21572407
MIRT548186	hsa-miR-584-5p	PAR-CLIP	21572407
MIRT548185	hsa-miR-3064-3p	PAR-CLIP	21572407
MIRT548184	hsa-miR-4715-3p	PAR-CLIP	21572407
MIRT548195	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT548194	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT548193	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT548192	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT548191	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT548190	hsa-miR-218-2-3p	PAR-CLIP	21572407
MIRT548189	hsa-miR-758-5p	PAR-CLIP	21572407
MIRT548188	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT548187	hsa-miR-496	PAR-CLIP	21572407
MIRT548186	hsa-miR-584-5p	PAR-CLIP	21572407
MIRT548185	hsa-miR-3064-3p	PAR-CLIP	21572407
MIRT548184	hsa-miR-4715-3p	PAR-CLIP	21572407
MIRT1001323	hsa-miR-106a	CLIP-seq
MIRT1001324	hsa-miR-106b	CLIP-seq
MIRT1001325	hsa-miR-1207-3p	CLIP-seq
MIRT1001326	hsa-miR-1231	CLIP-seq
MIRT1001327	hsa-miR-1243	CLIP-seq
MIRT1001328	hsa-miR-1255a	CLIP-seq
MIRT1001329	hsa-miR-1255b	CLIP-seq
MIRT1001330	hsa-miR-1267	CLIP-seq
MIRT1001331	hsa-miR-1275	CLIP-seq
MIRT1001332	hsa-miR-129-5p	CLIP-seq
MIRT1001333	hsa-miR-132	CLIP-seq
MIRT1001334	hsa-miR-141	CLIP-seq
MIRT1001335	hsa-miR-142-5p	CLIP-seq
MIRT1001336	hsa-miR-149	CLIP-seq
MIRT1001337	hsa-miR-17	CLIP-seq
MIRT1001338	hsa-miR-186	CLIP-seq
MIRT1001339	hsa-miR-1915	CLIP-seq
MIRT1001340	hsa-miR-194	CLIP-seq
MIRT1001341	hsa-miR-200a	CLIP-seq
MIRT1001342	hsa-miR-203	CLIP-seq
MIRT1001343	hsa-miR-204	CLIP-seq
MIRT1001344	hsa-miR-2052	CLIP-seq
MIRT1001345	hsa-miR-2054	CLIP-seq
MIRT1001346	hsa-miR-20a	CLIP-seq
MIRT1001347	hsa-miR-20b	CLIP-seq
MIRT1001348	hsa-miR-211	CLIP-seq
MIRT1001349	hsa-miR-212	CLIP-seq
MIRT1001350	hsa-miR-2276	CLIP-seq
MIRT1001351	hsa-miR-23a	CLIP-seq
MIRT1001352	hsa-miR-23b	CLIP-seq
MIRT1001353	hsa-miR-23c	CLIP-seq
MIRT1001354	hsa-miR-2681	CLIP-seq
MIRT1001355	hsa-miR-3064-5p	CLIP-seq
MIRT1001356	hsa-miR-3074-3p	CLIP-seq
MIRT1001357	hsa-miR-30a	CLIP-seq
MIRT1001358	hsa-miR-30b	CLIP-seq
MIRT1001359	hsa-miR-30c	CLIP-seq
MIRT1001360	hsa-miR-30d	CLIP-seq
MIRT1001361	hsa-miR-30e	CLIP-seq
MIRT1001362	hsa-miR-3132	CLIP-seq
MIRT1001363	hsa-miR-3133	CLIP-seq
MIRT1001364	hsa-miR-3147	CLIP-seq
MIRT1001365	hsa-miR-3150b-3p	CLIP-seq
MIRT1001366	hsa-miR-3153	CLIP-seq
MIRT1001367	hsa-miR-3159	CLIP-seq
MIRT1001368	hsa-miR-3161	CLIP-seq
MIRT1001369	hsa-miR-3170	CLIP-seq
MIRT1001370	hsa-miR-3190	CLIP-seq
MIRT1001371	hsa-miR-323b-5p	CLIP-seq
MIRT1001372	hsa-miR-330-3p	CLIP-seq
MIRT1001373	hsa-miR-338-3p	CLIP-seq
MIRT1001374	hsa-miR-338-5p	CLIP-seq
MIRT1001375	hsa-miR-3591-3p	CLIP-seq
MIRT1001376	hsa-miR-361-3p	CLIP-seq
MIRT1001377	hsa-miR-3616-3p	CLIP-seq
MIRT1001378	hsa-miR-3619-3p	CLIP-seq
MIRT1001379	hsa-miR-3646	CLIP-seq
MIRT1001380	hsa-miR-3658	CLIP-seq
MIRT1001381	hsa-miR-3662	CLIP-seq
MIRT1001382	hsa-miR-3674	CLIP-seq
MIRT1001383	hsa-miR-3691-5p	CLIP-seq
MIRT1001384	hsa-miR-374a	CLIP-seq
MIRT1001385	hsa-miR-374b	CLIP-seq
MIRT1001386	hsa-miR-3918	CLIP-seq
MIRT1001387	hsa-miR-3936	CLIP-seq
MIRT1001388	hsa-miR-3938	CLIP-seq
MIRT1001389	hsa-miR-3978	CLIP-seq
MIRT1001390	hsa-miR-410	CLIP-seq
MIRT1001391	hsa-miR-4260	CLIP-seq
MIRT1001392	hsa-miR-4267	CLIP-seq
MIRT1001393	hsa-miR-431	CLIP-seq
MIRT1001394	hsa-miR-4311	CLIP-seq
MIRT1001395	hsa-miR-4318	CLIP-seq
MIRT1001396	hsa-miR-4325	CLIP-seq
MIRT1001397	hsa-miR-4422	CLIP-seq
MIRT1001398	hsa-miR-4425	CLIP-seq
MIRT1001399	hsa-miR-4451	CLIP-seq
MIRT1001400	hsa-miR-4476	CLIP-seq
MIRT1001401	hsa-miR-450b-3p	CLIP-seq
MIRT1001402	hsa-miR-450b-5p	CLIP-seq
MIRT1001403	hsa-miR-451b	CLIP-seq
MIRT1001404	hsa-miR-4525	CLIP-seq
MIRT1001405	hsa-miR-4529-5p	CLIP-seq
MIRT1001406	hsa-miR-4533	CLIP-seq
MIRT1001407	hsa-miR-4535	CLIP-seq
MIRT1001408	hsa-miR-4637	CLIP-seq
MIRT1001409	hsa-miR-4665-5p	CLIP-seq
MIRT1001410	hsa-miR-4666-3p	CLIP-seq
MIRT1001411	hsa-miR-4685-5p	CLIP-seq
MIRT1001412	hsa-miR-4694-3p	CLIP-seq
MIRT1001413	hsa-miR-4701-5p	CLIP-seq
MIRT1001414	hsa-miR-4705	CLIP-seq
MIRT1001415	hsa-miR-4721	CLIP-seq
MIRT1001416	hsa-miR-4723-5p	CLIP-seq
MIRT1001417	hsa-miR-4724-5p	CLIP-seq
MIRT1001418	hsa-miR-4726-3p	CLIP-seq
MIRT1001419	hsa-miR-4729	CLIP-seq
MIRT1001420	hsa-miR-4731-3p	CLIP-seq
MIRT1001421	hsa-miR-4752	CLIP-seq
MIRT1001422	hsa-miR-4755-5p	CLIP-seq
MIRT1001423	hsa-miR-4768-5p	CLIP-seq
MIRT1001424	hsa-miR-4772-3p	CLIP-seq
MIRT1001425	hsa-miR-4775	CLIP-seq
MIRT1001426	hsa-miR-4776-5p	CLIP-seq
MIRT1001427	hsa-miR-4777-3p	CLIP-seq
MIRT1001428	hsa-miR-4784	CLIP-seq
MIRT1001429	hsa-miR-4789-5p	CLIP-seq
MIRT1001430	hsa-miR-4794	CLIP-seq
MIRT1001431	hsa-miR-4801	CLIP-seq
MIRT1001432	hsa-miR-494	CLIP-seq
MIRT1001433	hsa-miR-507	CLIP-seq
MIRT1001434	hsa-miR-511	CLIP-seq
MIRT1001435	hsa-miR-516b	CLIP-seq
MIRT1001436	hsa-miR-518a-5p	CLIP-seq
MIRT1001437	hsa-miR-519a	CLIP-seq
MIRT1001438	hsa-miR-519b-3p	CLIP-seq
MIRT1001439	hsa-miR-519c-3p	CLIP-seq
MIRT1001440	hsa-miR-519d	CLIP-seq
MIRT1001441	hsa-miR-520d-5p	CLIP-seq
MIRT1001442	hsa-miR-522	CLIP-seq
MIRT1001443	hsa-miR-524-5p	CLIP-seq
MIRT1001444	hsa-miR-526b	CLIP-seq
MIRT1001445	hsa-miR-527	CLIP-seq
MIRT1001446	hsa-miR-539	CLIP-seq
MIRT1001447	hsa-miR-548a-5p	CLIP-seq
MIRT1001448	hsa-miR-548ab	CLIP-seq
MIRT1001449	hsa-miR-548ak	CLIP-seq
MIRT1001450	hsa-miR-548b-5p	CLIP-seq
MIRT1001451	hsa-miR-548c-3p	CLIP-seq
MIRT1001452	hsa-miR-548c-5p	CLIP-seq
MIRT1001453	hsa-miR-548d-5p	CLIP-seq
MIRT1001454	hsa-miR-548h	CLIP-seq
MIRT1001455	hsa-miR-548i	CLIP-seq
MIRT1001456	hsa-miR-548j	CLIP-seq
MIRT1001457	hsa-miR-548k	CLIP-seq
MIRT1001458	hsa-miR-548l	CLIP-seq
MIRT1001459	hsa-miR-548w	CLIP-seq
MIRT1001460	hsa-miR-548y	CLIP-seq
MIRT1001461	hsa-miR-556-3p	CLIP-seq
MIRT1001462	hsa-miR-557	CLIP-seq
MIRT1001463	hsa-miR-559	CLIP-seq
MIRT1001464	hsa-miR-580	CLIP-seq
MIRT1001465	hsa-miR-583	CLIP-seq
MIRT1001466	hsa-miR-584	CLIP-seq
MIRT1001467	hsa-miR-588	CLIP-seq
MIRT1001468	hsa-miR-590-3p	CLIP-seq
MIRT1001469	hsa-miR-591	CLIP-seq
MIRT1001470	hsa-miR-615-5p	CLIP-seq
MIRT1001471	hsa-miR-623	CLIP-seq
MIRT1001472	hsa-miR-625	CLIP-seq
MIRT1001473	hsa-miR-634	CLIP-seq
MIRT1001474	hsa-miR-637	CLIP-seq
MIRT1001475	hsa-miR-654-3p	CLIP-seq
MIRT1001476	hsa-miR-765	CLIP-seq
MIRT1001477	hsa-miR-769-3p	CLIP-seq
MIRT1001478	hsa-miR-802	CLIP-seq
MIRT1001479	hsa-miR-93	CLIP-seq
MIRT1001323	hsa-miR-106a	CLIP-seq
MIRT1001324	hsa-miR-106b	CLIP-seq
MIRT1001327	hsa-miR-1243	CLIP-seq
MIRT1001328	hsa-miR-1255a	CLIP-seq
MIRT1001329	hsa-miR-1255b	CLIP-seq
MIRT1001330	hsa-miR-1267	CLIP-seq
MIRT1996751	hsa-miR-1273g	CLIP-seq
MIRT1001331	hsa-miR-1275	CLIP-seq
MIRT1001332	hsa-miR-129-5p	CLIP-seq
MIRT1001333	hsa-miR-132	CLIP-seq
MIRT1001334	hsa-miR-141	CLIP-seq
MIRT1001335	hsa-miR-142-5p	CLIP-seq
MIRT1996752	hsa-miR-147	CLIP-seq
MIRT1001337	hsa-miR-17	CLIP-seq
MIRT1996753	hsa-miR-183	CLIP-seq
MIRT1001338	hsa-miR-186	CLIP-seq
MIRT1001339	hsa-miR-1915	CLIP-seq
MIRT1001340	hsa-miR-194	CLIP-seq
MIRT1001341	hsa-miR-200a	CLIP-seq
MIRT1001345	hsa-miR-2054	CLIP-seq
MIRT1001346	hsa-miR-20a	CLIP-seq
MIRT1001347	hsa-miR-20b	CLIP-seq
MIRT1001349	hsa-miR-212	CLIP-seq
MIRT1001350	hsa-miR-2276	CLIP-seq
MIRT1001351	hsa-miR-23a	CLIP-seq
MIRT1001352	hsa-miR-23b	CLIP-seq
MIRT1001353	hsa-miR-23c	CLIP-seq
MIRT1001354	hsa-miR-2681	CLIP-seq
MIRT1001356	hsa-miR-3074-3p	CLIP-seq
MIRT1001357	hsa-miR-30a	CLIP-seq
MIRT1001358	hsa-miR-30b	CLIP-seq
MIRT1001359	hsa-miR-30c	CLIP-seq
MIRT1001360	hsa-miR-30d	CLIP-seq
MIRT1001361	hsa-miR-30e	CLIP-seq
MIRT1001362	hsa-miR-3132	CLIP-seq
MIRT1001365	hsa-miR-3150b-3p	CLIP-seq
MIRT1001366	hsa-miR-3153	CLIP-seq
MIRT1001367	hsa-miR-3159	CLIP-seq
MIRT1001368	hsa-miR-3161	CLIP-seq
MIRT1001369	hsa-miR-3170	CLIP-seq
MIRT1001370	hsa-miR-3190	CLIP-seq
MIRT1001371	hsa-miR-323b-5p	CLIP-seq
MIRT1001372	hsa-miR-330-3p	CLIP-seq
MIRT1001374	hsa-miR-338-5p	CLIP-seq
MIRT1001375	hsa-miR-3591-3p	CLIP-seq
MIRT1001378	hsa-miR-3619-3p	CLIP-seq
MIRT1001380	hsa-miR-3658	CLIP-seq
MIRT1001381	hsa-miR-3662	CLIP-seq
MIRT1001382	hsa-miR-3674	CLIP-seq
MIRT1001383	hsa-miR-3691-5p	CLIP-seq
MIRT1996754	hsa-miR-380	CLIP-seq
MIRT1996755	hsa-miR-3911	CLIP-seq
MIRT1996756	hsa-miR-3915	CLIP-seq
MIRT1001386	hsa-miR-3918	CLIP-seq
MIRT1996757	hsa-miR-3924	CLIP-seq
MIRT1996758	hsa-miR-3928	CLIP-seq
MIRT1001387	hsa-miR-3936	CLIP-seq
MIRT1001389	hsa-miR-3978	CLIP-seq
MIRT1001390	hsa-miR-410	CLIP-seq
MIRT1001391	hsa-miR-4260	CLIP-seq
MIRT1996759	hsa-miR-4280	CLIP-seq
MIRT1001393	hsa-miR-431	CLIP-seq
MIRT1001394	hsa-miR-4311	CLIP-seq
MIRT1001395	hsa-miR-4318	CLIP-seq
MIRT1996760	hsa-miR-432	CLIP-seq
MIRT1001396	hsa-miR-4325	CLIP-seq
MIRT1001399	hsa-miR-4451	CLIP-seq
MIRT1001400	hsa-miR-4476	CLIP-seq
MIRT1996761	hsa-miR-4495	CLIP-seq
MIRT1001401	hsa-miR-450b-3p	CLIP-seq
MIRT1001402	hsa-miR-450b-5p	CLIP-seq
MIRT1001403	hsa-miR-451b	CLIP-seq
MIRT1001404	hsa-miR-4525	CLIP-seq
MIRT1001405	hsa-miR-4529-5p	CLIP-seq
MIRT1001406	hsa-miR-4533	CLIP-seq
MIRT1001407	hsa-miR-4535	CLIP-seq
MIRT1001409	hsa-miR-4665-5p	CLIP-seq
MIRT1001410	hsa-miR-4666-3p	CLIP-seq
MIRT1001411	hsa-miR-4685-5p	CLIP-seq
MIRT1001413	hsa-miR-4701-5p	CLIP-seq
MIRT1001414	hsa-miR-4705	CLIP-seq
MIRT1001416	hsa-miR-4723-5p	CLIP-seq
MIRT1001418	hsa-miR-4726-3p	CLIP-seq
MIRT1996762	hsa-miR-4728-3p	CLIP-seq
MIRT1001420	hsa-miR-4731-3p	CLIP-seq
MIRT1001421	hsa-miR-4752	CLIP-seq
MIRT1001424	hsa-miR-4772-3p	CLIP-seq
MIRT1001425	hsa-miR-4775	CLIP-seq
MIRT1001426	hsa-miR-4776-5p	CLIP-seq
MIRT1001427	hsa-miR-4777-3p	CLIP-seq
MIRT1001428	hsa-miR-4784	CLIP-seq
MIRT1001429	hsa-miR-4789-5p	CLIP-seq
MIRT1996763	hsa-miR-4795-3p	CLIP-seq
MIRT1001431	hsa-miR-4801	CLIP-seq
MIRT1001432	hsa-miR-494	CLIP-seq
MIRT1001433	hsa-miR-507	CLIP-seq
MIRT1001434	hsa-miR-511	CLIP-seq
MIRT1001436	hsa-miR-518a-5p	CLIP-seq
MIRT1001437	hsa-miR-519a	CLIP-seq
MIRT1001438	hsa-miR-519b-3p	CLIP-seq
MIRT1001439	hsa-miR-519c-3p	CLIP-seq
MIRT1001440	hsa-miR-519d	CLIP-seq
MIRT1001441	hsa-miR-520d-5p	CLIP-seq
MIRT1001443	hsa-miR-524-5p	CLIP-seq
MIRT1001444	hsa-miR-526b	CLIP-seq
MIRT1001445	hsa-miR-527	CLIP-seq
MIRT1001447	hsa-miR-548a-5p	CLIP-seq
MIRT1001448	hsa-miR-548ab	CLIP-seq
MIRT1001449	hsa-miR-548ak	CLIP-seq
MIRT1001450	hsa-miR-548b-5p	CLIP-seq
MIRT1001451	hsa-miR-548c-3p	CLIP-seq
MIRT1001452	hsa-miR-548c-5p	CLIP-seq
MIRT1001453	hsa-miR-548d-5p	CLIP-seq
MIRT1001454	hsa-miR-548h	CLIP-seq
MIRT1001455	hsa-miR-548i	CLIP-seq
MIRT1001456	hsa-miR-548j	CLIP-seq
MIRT1001457	hsa-miR-548k	CLIP-seq
MIRT1001458	hsa-miR-548l	CLIP-seq
MIRT1001459	hsa-miR-548w	CLIP-seq
MIRT1001460	hsa-miR-548y	CLIP-seq
MIRT1001461	hsa-miR-556-3p	CLIP-seq
MIRT1001462	hsa-miR-557	CLIP-seq
MIRT1001463	hsa-miR-559	CLIP-seq
MIRT1001464	hsa-miR-580	CLIP-seq
MIRT1001465	hsa-miR-583	CLIP-seq
MIRT1001466	hsa-miR-584	CLIP-seq
MIRT1001467	hsa-miR-588	CLIP-seq
MIRT1001468	hsa-miR-590-3p	CLIP-seq
MIRT1001469	hsa-miR-591	CLIP-seq
MIRT1996764	hsa-miR-599	CLIP-seq
MIRT1001470	hsa-miR-615-5p	CLIP-seq
MIRT1001472	hsa-miR-625	CLIP-seq
MIRT1001474	hsa-miR-637	CLIP-seq
MIRT1996765	hsa-miR-644	CLIP-seq
MIRT1996766	hsa-miR-659	CLIP-seq
MIRT1001476	hsa-miR-765	CLIP-seq
MIRT1001477	hsa-miR-769-3p	CLIP-seq
MIRT1001478	hsa-miR-802	CLIP-seq
MIRT1001479	hsa-miR-93	CLIP-seq
MIRT1001323	hsa-miR-106a	CLIP-seq
MIRT1001324	hsa-miR-106b	CLIP-seq
MIRT2230693	hsa-miR-1200	CLIP-seq
MIRT1001325	hsa-miR-1207-3p	CLIP-seq
MIRT1001326	hsa-miR-1231	CLIP-seq
MIRT1001327	hsa-miR-1243	CLIP-seq
MIRT1001328	hsa-miR-1255a	CLIP-seq
MIRT1001329	hsa-miR-1255b	CLIP-seq
MIRT2230694	hsa-miR-1265	CLIP-seq
MIRT1001330	hsa-miR-1267	CLIP-seq
MIRT1996751	hsa-miR-1273g	CLIP-seq
MIRT1001331	hsa-miR-1275	CLIP-seq
MIRT1001333	hsa-miR-132	CLIP-seq
MIRT1001334	hsa-miR-141	CLIP-seq
MIRT1001335	hsa-miR-142-5p	CLIP-seq
MIRT1996752	hsa-miR-147	CLIP-seq
MIRT1001336	hsa-miR-149	CLIP-seq
MIRT1001337	hsa-miR-17	CLIP-seq
MIRT1996753	hsa-miR-183	CLIP-seq
MIRT1001338	hsa-miR-186	CLIP-seq
MIRT1001339	hsa-miR-1915	CLIP-seq
MIRT1001340	hsa-miR-194	CLIP-seq
MIRT2230695	hsa-miR-197	CLIP-seq
MIRT1001341	hsa-miR-200a	CLIP-seq
MIRT1001342	hsa-miR-203	CLIP-seq
MIRT1001344	hsa-miR-2052	CLIP-seq
MIRT1001346	hsa-miR-20a	CLIP-seq
MIRT1001347	hsa-miR-20b	CLIP-seq
MIRT1001349	hsa-miR-212	CLIP-seq
MIRT1001350	hsa-miR-2276	CLIP-seq
MIRT1001351	hsa-miR-23a	CLIP-seq
MIRT1001352	hsa-miR-23b	CLIP-seq
MIRT1001353	hsa-miR-23c	CLIP-seq
MIRT1001354	hsa-miR-2681	CLIP-seq
MIRT1001355	hsa-miR-3064-5p	CLIP-seq
MIRT1001356	hsa-miR-3074-3p	CLIP-seq
MIRT1001357	hsa-miR-30a	CLIP-seq
MIRT1001358	hsa-miR-30b	CLIP-seq
MIRT1001359	hsa-miR-30c	CLIP-seq
MIRT1001360	hsa-miR-30d	CLIP-seq
MIRT1001361	hsa-miR-30e	CLIP-seq
MIRT2230696	hsa-miR-3129-3p	CLIP-seq
MIRT1001362	hsa-miR-3132	CLIP-seq
MIRT1001363	hsa-miR-3133	CLIP-seq
MIRT2230697	hsa-miR-3143	CLIP-seq
MIRT1001364	hsa-miR-3147	CLIP-seq
MIRT1001365	hsa-miR-3150b-3p	CLIP-seq
MIRT1001366	hsa-miR-3153	CLIP-seq
MIRT1001367	hsa-miR-3159	CLIP-seq
MIRT1001368	hsa-miR-3161	CLIP-seq
MIRT1001369	hsa-miR-3170	CLIP-seq
MIRT1001370	hsa-miR-3190	CLIP-seq
MIRT2230698	hsa-miR-3200-5p	CLIP-seq
MIRT1001371	hsa-miR-323b-5p	CLIP-seq
MIRT1001372	hsa-miR-330-3p	CLIP-seq
MIRT1001373	hsa-miR-338-3p	CLIP-seq
MIRT1001374	hsa-miR-338-5p	CLIP-seq
MIRT1001375	hsa-miR-3591-3p	CLIP-seq
MIRT2230699	hsa-miR-3605-5p	CLIP-seq
MIRT1001376	hsa-miR-361-3p	CLIP-seq
MIRT2230700	hsa-miR-361-5p	CLIP-seq
MIRT1001377	hsa-miR-3616-3p	CLIP-seq
MIRT2230701	hsa-miR-3617	CLIP-seq
MIRT2230702	hsa-miR-3618	CLIP-seq
MIRT1001378	hsa-miR-3619-3p	CLIP-seq
MIRT1001380	hsa-miR-3658	CLIP-seq
MIRT1001381	hsa-miR-3662	CLIP-seq
MIRT1001382	hsa-miR-3674	CLIP-seq
MIRT1001383	hsa-miR-3691-5p	CLIP-seq
MIRT2230703	hsa-miR-3692	CLIP-seq
MIRT1001384	hsa-miR-374a	CLIP-seq
MIRT1001385	hsa-miR-374b	CLIP-seq
MIRT1996754	hsa-miR-380	CLIP-seq
MIRT1996755	hsa-miR-3911	CLIP-seq
MIRT1996756	hsa-miR-3915	CLIP-seq
MIRT1001386	hsa-miR-3918	CLIP-seq
MIRT1996757	hsa-miR-3924	CLIP-seq
MIRT1996758	hsa-miR-3928	CLIP-seq
MIRT1001387	hsa-miR-3936	CLIP-seq
MIRT1001389	hsa-miR-3978	CLIP-seq
MIRT1001390	hsa-miR-410	CLIP-seq
MIRT2230704	hsa-miR-412	CLIP-seq
MIRT1001391	hsa-miR-4260	CLIP-seq
MIRT1001392	hsa-miR-4267	CLIP-seq
MIRT1996759	hsa-miR-4280	CLIP-seq
MIRT2230705	hsa-miR-4303	CLIP-seq
MIRT1001393	hsa-miR-431	CLIP-seq
MIRT1001394	hsa-miR-4311	CLIP-seq
MIRT1001395	hsa-miR-4318	CLIP-seq
MIRT1996760	hsa-miR-432	CLIP-seq
MIRT2230706	hsa-miR-4324	CLIP-seq
MIRT1001396	hsa-miR-4325	CLIP-seq
MIRT1001397	hsa-miR-4422	CLIP-seq
MIRT1001398	hsa-miR-4425	CLIP-seq
MIRT1001399	hsa-miR-4451	CLIP-seq
MIRT2230707	hsa-miR-4461	CLIP-seq
MIRT1001400	hsa-miR-4476	CLIP-seq
MIRT2230708	hsa-miR-4490	CLIP-seq
MIRT1996761	hsa-miR-4495	CLIP-seq
MIRT2230709	hsa-miR-4501	CLIP-seq
MIRT2230710	hsa-miR-4502	CLIP-seq
MIRT1001401	hsa-miR-450b-3p	CLIP-seq
MIRT1001402	hsa-miR-450b-5p	CLIP-seq
MIRT1001403	hsa-miR-451b	CLIP-seq
MIRT1001404	hsa-miR-4525	CLIP-seq
MIRT1001405	hsa-miR-4529-5p	CLIP-seq
MIRT1001406	hsa-miR-4533	CLIP-seq
MIRT1001407	hsa-miR-4535	CLIP-seq
MIRT1001408	hsa-miR-4637	CLIP-seq
MIRT2230711	hsa-miR-4643	CLIP-seq
MIRT2230712	hsa-miR-4659a-3p	CLIP-seq
MIRT2230713	hsa-miR-4659b-3p	CLIP-seq
MIRT2230714	hsa-miR-466	CLIP-seq
MIRT1001409	hsa-miR-4665-5p	CLIP-seq
MIRT1001410	hsa-miR-4666-3p	CLIP-seq
MIRT2230715	hsa-miR-4666-5p	CLIP-seq
MIRT2230716	hsa-miR-4668-3p	CLIP-seq
MIRT1001411	hsa-miR-4685-5p	CLIP-seq
MIRT2230717	hsa-miR-4686	CLIP-seq
MIRT1001413	hsa-miR-4701-5p	CLIP-seq
MIRT1001414	hsa-miR-4705	CLIP-seq
MIRT1001415	hsa-miR-4721	CLIP-seq
MIRT1001416	hsa-miR-4723-5p	CLIP-seq
MIRT1001418	hsa-miR-4726-3p	CLIP-seq
MIRT1996762	hsa-miR-4728-3p	CLIP-seq
MIRT1001419	hsa-miR-4729	CLIP-seq
MIRT1001420	hsa-miR-4731-3p	CLIP-seq
MIRT2230718	hsa-miR-4735-5p	CLIP-seq
MIRT1001421	hsa-miR-4752	CLIP-seq
MIRT1001423	hsa-miR-4768-5p	CLIP-seq
MIRT1001424	hsa-miR-4772-3p	CLIP-seq
MIRT2230719	hsa-miR-4774-5p	CLIP-seq
MIRT1001425	hsa-miR-4775	CLIP-seq
MIRT1001426	hsa-miR-4776-5p	CLIP-seq
MIRT1001427	hsa-miR-4777-3p	CLIP-seq
MIRT1001428	hsa-miR-4784	CLIP-seq
MIRT2230720	hsa-miR-4789-3p	CLIP-seq
MIRT1001429	hsa-miR-4789-5p	CLIP-seq
MIRT1001430	hsa-miR-4794	CLIP-seq
MIRT1996763	hsa-miR-4795-3p	CLIP-seq
MIRT1001431	hsa-miR-4801	CLIP-seq
MIRT1001432	hsa-miR-494	CLIP-seq
MIRT1001433	hsa-miR-507	CLIP-seq
MIRT1001434	hsa-miR-511	CLIP-seq
MIRT1001435	hsa-miR-516b	CLIP-seq
MIRT1001436	hsa-miR-518a-5p	CLIP-seq
MIRT1001437	hsa-miR-519a	CLIP-seq
MIRT1001438	hsa-miR-519b-3p	CLIP-seq
MIRT1001439	hsa-miR-519c-3p	CLIP-seq
MIRT1001440	hsa-miR-519d	CLIP-seq
MIRT1001444	hsa-miR-526b	CLIP-seq
MIRT1001445	hsa-miR-527	CLIP-seq
MIRT1001446	hsa-miR-539	CLIP-seq
MIRT2230721	hsa-miR-543	CLIP-seq
MIRT2230722	hsa-miR-544b	CLIP-seq
MIRT1001447	hsa-miR-548a-5p	CLIP-seq
MIRT1001448	hsa-miR-548ab	CLIP-seq
MIRT1001449	hsa-miR-548ak	CLIP-seq
MIRT1001450	hsa-miR-548b-5p	CLIP-seq
MIRT1001451	hsa-miR-548c-3p	CLIP-seq
MIRT1001452	hsa-miR-548c-5p	CLIP-seq
MIRT1001453	hsa-miR-548d-5p	CLIP-seq
MIRT1001454	hsa-miR-548h	CLIP-seq
MIRT1001455	hsa-miR-548i	CLIP-seq
MIRT1001456	hsa-miR-548j	CLIP-seq
MIRT1001457	hsa-miR-548k	CLIP-seq
MIRT1001458	hsa-miR-548l	CLIP-seq
MIRT2230723	hsa-miR-548u	CLIP-seq
MIRT1001459	hsa-miR-548w	CLIP-seq
MIRT1001460	hsa-miR-548y	CLIP-seq
MIRT1001461	hsa-miR-556-3p	CLIP-seq
MIRT1001462	hsa-miR-557	CLIP-seq
MIRT1001463	hsa-miR-559	CLIP-seq
MIRT2230724	hsa-miR-579	CLIP-seq
MIRT1001464	hsa-miR-580	CLIP-seq
MIRT1001465	hsa-miR-583	CLIP-seq
MIRT1001466	hsa-miR-584	CLIP-seq
MIRT1001467	hsa-miR-588	CLIP-seq
MIRT1001468	hsa-miR-590-3p	CLIP-seq
MIRT1001469	hsa-miR-591	CLIP-seq
MIRT1996764	hsa-miR-599	CLIP-seq
MIRT1001470	hsa-miR-615-5p	CLIP-seq
MIRT1001472	hsa-miR-625	CLIP-seq
MIRT1001473	hsa-miR-634	CLIP-seq
MIRT1001474	hsa-miR-637	CLIP-seq
MIRT2230725	hsa-miR-641	CLIP-seq
MIRT1996765	hsa-miR-644	CLIP-seq
MIRT1001475	hsa-miR-654-3p	CLIP-seq
MIRT1996766	hsa-miR-659	CLIP-seq
MIRT2230726	hsa-miR-760	CLIP-seq
MIRT1001476	hsa-miR-765	CLIP-seq
MIRT1001477	hsa-miR-769-3p	CLIP-seq
MIRT1001478	hsa-miR-802	CLIP-seq
MIRT1001479	hsa-miR-93	CLIP-seq
MIRT2230727	hsa-miR-934	CLIP-seq
MIRT1001327	hsa-miR-1243	CLIP-seq
MIRT1001328	hsa-miR-1255a	CLIP-seq
MIRT1001329	hsa-miR-1255b	CLIP-seq
MIRT1001338	hsa-miR-186	CLIP-seq
MIRT1001381	hsa-miR-3662	CLIP-seq
MIRT1001432	hsa-miR-494	CLIP-seq
MIRT1001366	hsa-miR-3153	CLIP-seq
MIRT1001394	hsa-miR-4311	CLIP-seq
MIRT1001465	hsa-miR-583	CLIP-seq
MIRT1001366	hsa-miR-3153	CLIP-seq
MIRT1001394	hsa-miR-4311	CLIP-seq
MIRT1001465	hsa-miR-583	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
AR	Unknown	12750453
CREB1	Unknown	22577344
FOS	Unknown	22577344
TFAP2A	Unknown	22577344

Show/Hide all (73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	16087863, 16331276, 19127412
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	25802280
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IC	25802280
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IDA	9931457
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8652662
GO:0005515	Function	Protein binding	IPI	22722839, 23260764, 33640491
GO:0005634	Component	Nucleus	IDA	9931457, 20160041
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005902	Component	Microvillus	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	20160041
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021904	Process	Dorsal/ventral neural tube patterning	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030324	Process	Lung development	IEA
GO:0032355	Process	Response to estradiol	IDA	16087863
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IMP	16087863
GO:0035239	Process	Tube morphogenesis	IEA
GO:0042445	Process	Hormone metabolic process	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	19127412
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	16087863
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16331276, 19127412, 20160041
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16087863
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048665	Process	Neuron fate specification	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	16087863
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060441	Process	Epithelial tube branching involved in lung morphogenesis	IEA
GO:0060487	Process	Lung epithelial cell differentiation	IEA
GO:0060528	Process	Secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development	IEA
GO:0060739	Process	Mesenchymal-epithelial cell signaling involved in prostate gland development	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0060741	Process	Prostate gland stromal morphogenesis	IEA
GO:0060743	Process	Epithelial cell maturation involved in prostate gland development	IEA
GO:0061144	Process	Alveolar secondary septum development	IEA
GO:0061448	Process	Connective tissue development	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	TAS	24431302
GO:1902691	Process	Respiratory basal cell differentiation	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IC	25802280
GO:1904340	Process	Positive regulation of dopaminergic neuron differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IC	20160041

MIM	HGNC	e!Ensembl
602294	5021	ENSG00000129514

P55317

Protein name

Hepatocyte nuclear factor 3-alpha (HNF-3-alpha) (HNF-3A) (Forkhead box protein A1) (Transcription factor 3A) (TCF-3A)

Protein function

Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin

PDB

7VOX , 8VFY , 8VFZ , 8VG1 , 8VG2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08430	Forkhead_N	17 → 169	Forkhead N-terminal region	Family
PF00250	Forkhead	169 → 255	Forkhead domain	Domain
PF09354	HNF_C	397 → 461	HNF3 C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in prostate and ESR1-positive breast tumors. Overexpressed in esophageal and lung adenocarcinomas. {ECO:0000269|PubMed:12234996, ECO:0000269|PubMed:15987773, ECO:0000269|PubMed:16331276}.

Sequence

MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ
AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT
MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK
GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA
SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI
SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS

Sequence length

472

Interactions

View interactions

	Reactome
			Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (163)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	12234996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22383183, 28209524, 28319070, 8652662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12234996, 26658322, 30475207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	19470727, 28546130, 31500506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	29880907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	22115363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31430856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31430856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	24596378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30061015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25071007, 27898096, 27924948, 28721490, 30670749, 31636388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	30881995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15149721, 16087863, 16331276, 17163418, 18037662, 19261198, 19486887, 19946260, 20181721, 20501593, 20691160, 20697807, 22391567, 22476979, 22545144 View all (54 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	23001124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16087863, 16980581, 19549328, 19946260, 20068169, 20132413, 20501593, 21151129, 21167036, 21701558, 21878914, 21882221, 22272226, 22313737, 22391567 View all (78 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24887547, 38254989	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	26658322, 28488543, 30468461, 33296605, 37401400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16001449, 27898096, 28209524, 28721490, 29993139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	33844251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28673244, 30382079, 35968505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29208003	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	27215483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	24596378	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	26451490, 31018945, 35477749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25071007, 27898096, 27924948, 28721490, 30670749, 31636388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15492844, 22383183, 23022474, 24093963, 25122426, 30415009, 30475207, 31221478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28488543, 34042091, 36393971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20160041, 38044421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32696980	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27128972	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36323682	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28488543, 29541214		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30468461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30468461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32151057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	30416851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32839292	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27484093, 31081047, 31298352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27484093, 29297384, 30446877, 32207560, 32839292, 33296605, 33819484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29115609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28843920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30882397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31371698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	CTD_human_DG	29295717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	27791031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22313737, 27197147, 27349269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22313737, 24849812, 27829043, 36012038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	27197147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	26274503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28488543, 29541214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20043065, 27050876, 30944629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12234996, 20043065, 27050876, 30944629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31048097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	26542946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23318274		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	24469900		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	30497210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32513296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30497210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30233244, 30651786, 30914197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	30067725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26510790	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30709419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	30709419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24887547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	35203384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	26097584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	26097584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35931888	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38287425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34370624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25198130, 29085515, 29208003, 30496760, 30782188, 31400761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	27721404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22383183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24093963	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25281925, 26658322, 35897813, 38273748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27484093, 33844251	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33819484, 36345952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15149721, 16087863, 16331276, 17163418, 18037662, 19261198, 19486887, 20068169, 20181721, 20501593, 20691160, 21151129, 22391567, 22476979, 22545144 View all (56 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	23001124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22313737, 27197147, 27349269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20043065, 27050876, 30944629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28673244, 29424896, 31400761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15492844, 22383183, 23022474, 24093963, 25122426, 30415009, 30475207, 31221478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28488543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20160041, 28841414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17163418, 19220249, 19680443, 20628005, 21900400, 22083957, 22722839, 22879989, 23022474, 23063623, 23539448, 23661306, 24292680, 25329375, 25700553 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	22610119, 26457646, 29295717, 29610475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29129808, 30066917, 31046116, 31317696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19470727, 29523221, 30882397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25071007, 27898096, 27924948, 28721490, 30670749, 31636388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19220249, 22115363, 23001124, 25034661, 25264199, 25994056, 26658322, 26708273, 27034986, 27484093, 27634452, 28038451, 28238418, 28270510, 28488543 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30468461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	23001124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16009131, 16331276, 17373880, 17616709, 17671124, 18538561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16087863, 21882221, 22577344, 24758297, 25531315, 27378691, 27499099, 27524420, 30941644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	23001124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	23001124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28546130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	28238418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25913414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19667180, 30392786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26934447, 32685483, 35184697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	34503528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	30624964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30624964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17163418, 18037662, 20565980, 20932292, 22313737, 22383183, 22391567, 22476979, 22722839, 24758297, 24887547, 25755696, 26260807, 26544944, 27484093 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	22238690, 23318274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29072684, 29115441, 29665655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	24596378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	16980581, 19946260, 21947652, 22313737, 22577344, 23183268, 27791031, 28756535, 29758547, 30206966, 30819139, 30881995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	29630912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19371798, 29307778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29793327, 31432728, 31801112		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28488543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28488543, 33015769, 34215221, 36345952, 36393971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	29630912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20160041, 28841414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20160041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20160041, 28841414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	32696980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26516212, 29935433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26516212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28255498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	20160041, 28757253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19220249, 19680443, 20628005, 21900400, 22083957, 22722839, 22879989, 23022474, 23063623, 23539448, 23661306, 24292680, 25329375, 25700553, 25808853 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	38172600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	26542946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16001449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18178153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19680443, 21572438, 21900400, 21915096, 22083957, 22610119, 22722839, 22879989, 24423874, 25008967, 25329375, 25700553, 26542946, 26544944, 26743006 View all (29 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	22610119, 26457646, 29295717, 29610475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23539448, 31735626		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24292680	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24875621, 28319070	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	28849568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22986903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29115609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	27215483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27811935, 28849568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	35751045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20043065, 22383183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27050876, 27974698, 29788741, 31048097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22238690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	24469900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29129808, 30066917, 31046116, 31317696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30066917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	34425866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19470727, 28546130, 29523221, 30882397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19470727, 28546130, 29523221, 30882397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29523221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26260807, 26431101, 27959926, 29880907, 30146936, 31182923, 31540486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27959926, 29880907, 30146936, 31182923, 31843498, 32677589, 36157217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36291687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25071007, 33858483, 34706362, 36323682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27898096, 28721490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28767682, 35498155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30468461	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	31257497		★★★★★ ★☆☆☆☆ Found in Text Mining only

FOXA1 (forkhead box A1)