HMOX2 (heme oxygenase 2)

Gene

• Entrez ID: 3163
• Gene name: Heme oxygenase 2
• Gene symbol: HMOX2
• Synonyms (NCBI Gene): HO-2
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its subs

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045117	hsa-miR-186-5p	CLASH	23622248
MIRT1050169	hsa-miR-224	CLIP-seq
MIRT1050170	hsa-miR-3622a-3p	CLIP-seq
MIRT1050171	hsa-miR-3622b-3p	CLIP-seq
MIRT1050172	hsa-miR-4536	CLIP-seq
MIRT1050173	hsa-miR-544b	CLIP-seq
MIRT1050169	hsa-miR-224	CLIP-seq
MIRT2011485	hsa-miR-3127-5p	CLIP-seq
MIRT2011486	hsa-miR-3135b	CLIP-seq
MIRT2011487	hsa-miR-338-3p	CLIP-seq
MIRT2011488	hsa-miR-3545-5p	CLIP-seq
MIRT1050170	hsa-miR-3622a-3p	CLIP-seq
MIRT1050171	hsa-miR-3622b-3p	CLIP-seq
MIRT2011489	hsa-miR-3622b-5p	CLIP-seq
MIRT2011490	hsa-miR-3652	CLIP-seq
MIRT2011491	hsa-miR-3688-5p	CLIP-seq
MIRT2011492	hsa-miR-3918	CLIP-seq
MIRT2011493	hsa-miR-3936	CLIP-seq
MIRT2011494	hsa-miR-4310	CLIP-seq
MIRT2011495	hsa-miR-4423-5p	CLIP-seq
MIRT2011496	hsa-miR-4430	CLIP-seq
MIRT2011497	hsa-miR-4434	CLIP-seq
MIRT2011498	hsa-miR-4446-3p	CLIP-seq
MIRT2011499	hsa-miR-4492	CLIP-seq
MIRT2011500	hsa-miR-4498	CLIP-seq
MIRT2011501	hsa-miR-4516	CLIP-seq
MIRT2011502	hsa-miR-4531	CLIP-seq
MIRT1050172	hsa-miR-4536	CLIP-seq
MIRT2011503	hsa-miR-4717-5p	CLIP-seq
MIRT2011504	hsa-miR-4779	CLIP-seq
MIRT1050173	hsa-miR-544b	CLIP-seq
MIRT2011505	hsa-miR-644	CLIP-seq
MIRT2011506	hsa-miR-762	CLIP-seq
MIRT2011507	hsa-miR-765	CLIP-seq
MIRT1050169	hsa-miR-224	CLIP-seq
MIRT2011485	hsa-miR-3127-5p	CLIP-seq
MIRT2011486	hsa-miR-3135b	CLIP-seq
MIRT1050170	hsa-miR-3622a-3p	CLIP-seq
MIRT1050171	hsa-miR-3622b-3p	CLIP-seq
MIRT2011490	hsa-miR-3652	CLIP-seq
MIRT2011492	hsa-miR-3918	CLIP-seq
MIRT2011493	hsa-miR-3936	CLIP-seq
MIRT2011496	hsa-miR-4430	CLIP-seq
MIRT2011497	hsa-miR-4434	CLIP-seq
MIRT2243702	hsa-miR-4438	CLIP-seq
MIRT2011498	hsa-miR-4446-3p	CLIP-seq
MIRT2011499	hsa-miR-4492	CLIP-seq
MIRT2011500	hsa-miR-4498	CLIP-seq
MIRT2011501	hsa-miR-4516	CLIP-seq
MIRT2011502	hsa-miR-4531	CLIP-seq
MIRT1050172	hsa-miR-4536	CLIP-seq
MIRT2011503	hsa-miR-4717-5p	CLIP-seq
MIRT2243703	hsa-miR-5095	CLIP-seq
MIRT1050173	hsa-miR-544b	CLIP-seq
MIRT2011506	hsa-miR-762	CLIP-seq
MIRT2011507	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IDA	15528406
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IBA
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IDA	1575508, 7890772
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IEA
GO:0005515	Function	Protein binding	IPI	15528406, 32296183, 32814053
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	15528406
GO:0005886	Component	Plasma membrane	TAS
GO:0006788	Process	Heme oxidation	IBA
GO:0006788	Process	Heme oxidation	IEA
GO:0006979	Process	Response to oxidative stress	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0020037	Function	Heme binding	IBA
GO:0035579	Component	Specific granule membrane	TAS
GO:0042167	Process	Heme catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 141251
• HGNC: 5014
• e!Ensembl: ENSG00000103415

Protein

• UniProt ID: P30519
• Protein name: Heme oxygenase 2 (HO-2) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 2 soluble form]
• Protein function: [Heme oxygenase 2]: Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron. {ECO:0000269|PubMed
• PDB: 2Q32, 2QPP, 2RGZ, 4WMH, 5UC8, 5UC9, 5UCA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01126	Heme_oxygenase	31 → 236	Heme oxygenase	Domain

• Sequence:

  MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
  NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
  WEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
  GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
  GSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
  AAGVALAAGLLAWYYM

• Sequence length: 316

Pathways

KEGG:

Porphyrin metabolism
Metabolic pathways
Mineral absorption

Reactome:

Heme degradation
Neutrophil degranulation
Iron uptake and transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	16787441		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21647550, 21804464		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22549002	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	9527889		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30087547		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33550277	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35768804	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36769209	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30087547		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	22549002	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	12395377	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11872213, 22559824	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	19886851		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	26091465, 28276576		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	26091465	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	8764571		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	8764571		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	20118244	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	33401250	Associate	★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	30087547		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19886851		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16787441	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20118244	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	35644542	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	30196728		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36240204	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31215802		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	16489673	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	21647550	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31436967		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35232428	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22549002		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26868429	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31436967		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33550277	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21709601, 26091465, 28179208		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26091465, 34148545	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12797490	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	26313808, 31063999		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	26313808, 37563071	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	28115703		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	20118244	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	10974422		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	10974422		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	17989163		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28320388	Associate	★☆☆☆☆ Found in Text Mining only