Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3162
Gene name	Heme oxygenase 1
Gene symbol	HMOX1
Synonyms (NCBI Gene)	HMOX1DHO-1HSP32bK286B10
Chromosome	22
Chromosome location	22q12.3
Summary	Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its subs

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1601739478	->G	Likely-pathogenic	Coding sequence variant, frameshift variant

253

Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004719	hsa-miR-196a-5p	Luciferase reporter assayqRT-PCRWestern blot	20127796
MIRT001455	hsa-miR-16-5p	pSILAC	18668040
MIRT017714	hsa-miR-335-5p	Microarray	18185580
MIRT019368	hsa-miR-148b-3p	Microarray	17612493
MIRT021967	hsa-miR-128-3p	Microarray	17612493
MIRT022531	hsa-miR-124-3p	Microarray	18668037
MIRT023272	hsa-miR-122-5p	Western blot;qRT-PCR	20633528
MIRT023272	hsa-miR-122-5p	Microarray	17612493
MIRT023697	hsa-miR-1-3p	Proteomics	18668040
MIRT029307	hsa-miR-26b-5p	Microarray	19088304
MIRT001455	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT054754	hsa-miR-24-3p	Luciferase reporter assayWestern blot	24854275
MIRT462676	hsa-miR-5193	HITS-CLIP	23824327
MIRT462675	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT462674	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT462673	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT650816	hsa-miR-4448	HITS-CLIP	23824327
MIRT462656	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT462655	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT462654	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT462653	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT462652	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT650815	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT462650	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT462683	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT462682	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT462681	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462680	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT462679	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT021967	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT462678	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT462677	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT462676	hsa-miR-5193	PAR-CLIP	23592263
MIRT462675	hsa-miR-660-3p	PAR-CLIP	23592263
MIRT462674	hsa-miR-6734-3p	PAR-CLIP	23592263
MIRT462673	hsa-miR-3667-3p	PAR-CLIP	23592263
MIRT462672	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT462671	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT462670	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT462669	hsa-miR-4721	PAR-CLIP	23592263
MIRT462668	hsa-miR-7976	PAR-CLIP	23592263
MIRT462667	hsa-miR-3135b	PAR-CLIP	23592263
MIRT462666	hsa-miR-3612	PAR-CLIP	23592263
MIRT462665	hsa-miR-650	PAR-CLIP	23592263
MIRT462664	hsa-miR-1291	PAR-CLIP	23592263
MIRT462663	hsa-miR-6775-3p	PAR-CLIP	23592263
MIRT462662	hsa-miR-3652	PAR-CLIP	23592263
MIRT462661	hsa-miR-4430	PAR-CLIP	23592263
MIRT462660	hsa-miR-4492	PAR-CLIP	23592263
MIRT462659	hsa-miR-4498	PAR-CLIP	23592263
MIRT462658	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT462657	hsa-miR-762	PAR-CLIP	23592263
MIRT462656	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT462655	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT462654	hsa-miR-4691-5p	PAR-CLIP	23592263
MIRT462653	hsa-miR-6792-3p	PAR-CLIP	23592263
MIRT462652	hsa-miR-6749-3p	PAR-CLIP	23592263
MIRT462651	hsa-miR-4443	PAR-CLIP	23592263
MIRT462650	hsa-miR-3180-5p	PAR-CLIP	23592263
MIRT733875	hsa-miR-183-5p	Luciferase reporter assayqRT-PCRWestern blotting	32602850
MIRT735144	hsa-miR-135a-3p	Luciferase reporter assayWestern blottingqRT-PCR	32762552
MIRT735145	hsa-miR-135b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32762552
MIRT462676	hsa-miR-5193	HITS-CLIP	23824327
MIRT462675	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT462674	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT462673	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT650816	hsa-miR-4448	HITS-CLIP	23824327
MIRT462656	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT462655	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT462654	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT462653	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT462652	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT650815	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT462650	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT462683	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT462682	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT462681	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462680	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT462679	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT021967	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT462678	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT462677	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT462676	hsa-miR-5193	PAR-CLIP	23592263
MIRT462675	hsa-miR-660-3p	PAR-CLIP	23592263
MIRT462674	hsa-miR-6734-3p	PAR-CLIP	23592263
MIRT462673	hsa-miR-3667-3p	PAR-CLIP	23592263
MIRT462672	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT462671	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT462670	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT462669	hsa-miR-4721	PAR-CLIP	23592263
MIRT462668	hsa-miR-7976	PAR-CLIP	23592263
MIRT462667	hsa-miR-3135b	PAR-CLIP	23592263
MIRT462666	hsa-miR-3612	PAR-CLIP	23592263
MIRT462665	hsa-miR-650	PAR-CLIP	23592263
MIRT462664	hsa-miR-1291	PAR-CLIP	23592263
MIRT462663	hsa-miR-6775-3p	PAR-CLIP	23592263
MIRT462662	hsa-miR-3652	PAR-CLIP	23592263
MIRT462661	hsa-miR-4430	PAR-CLIP	23592263
MIRT462660	hsa-miR-4492	PAR-CLIP	23592263
MIRT462659	hsa-miR-4498	PAR-CLIP	23592263
MIRT462658	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT462657	hsa-miR-762	PAR-CLIP	23592263
MIRT462656	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT462655	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT462654	hsa-miR-4691-5p	PAR-CLIP	23592263
MIRT462653	hsa-miR-6792-3p	PAR-CLIP	23592263
MIRT462652	hsa-miR-6749-3p	PAR-CLIP	23592263
MIRT462651	hsa-miR-4443	PAR-CLIP	23592263
MIRT462650	hsa-miR-3180-5p	PAR-CLIP	23592263
MIRT1050128	hsa-miR-1185	CLIP-seq
MIRT1050129	hsa-miR-1245b-5p	CLIP-seq
MIRT1050130	hsa-miR-128	CLIP-seq
MIRT1050131	hsa-miR-1295	CLIP-seq
MIRT1050132	hsa-miR-1304	CLIP-seq
MIRT1050133	hsa-miR-200b	CLIP-seq
MIRT1050134	hsa-miR-200c	CLIP-seq
MIRT1050135	hsa-miR-217	CLIP-seq
MIRT1050136	hsa-miR-2467-5p	CLIP-seq
MIRT1050137	hsa-miR-3065-5p	CLIP-seq
MIRT1050138	hsa-miR-3142	CLIP-seq
MIRT1050139	hsa-miR-3163	CLIP-seq
MIRT1050140	hsa-miR-3188	CLIP-seq
MIRT1050141	hsa-miR-3687	CLIP-seq
MIRT1050142	hsa-miR-371-3p	CLIP-seq
MIRT1050143	hsa-miR-3922-5p	CLIP-seq
MIRT1050144	hsa-miR-3929	CLIP-seq
MIRT1050145	hsa-miR-3975	CLIP-seq
MIRT1050146	hsa-miR-429	CLIP-seq
MIRT1050147	hsa-miR-4297	CLIP-seq
MIRT1050148	hsa-miR-4313	CLIP-seq
MIRT1050149	hsa-miR-4418	CLIP-seq
MIRT1050150	hsa-miR-4419b	CLIP-seq
MIRT1050151	hsa-miR-4442	CLIP-seq
MIRT1050152	hsa-miR-4478	CLIP-seq
MIRT1050153	hsa-miR-4493	CLIP-seq
MIRT1050154	hsa-miR-4663	CLIP-seq
MIRT1050155	hsa-miR-4670-3p	CLIP-seq
MIRT1050156	hsa-miR-4717-5p	CLIP-seq
MIRT1050157	hsa-miR-4753-5p	CLIP-seq
MIRT1050158	hsa-miR-485-5p	CLIP-seq
MIRT1050159	hsa-miR-509-3-5p	CLIP-seq
MIRT1050160	hsa-miR-509-5p	CLIP-seq
MIRT1050161	hsa-miR-548ac	CLIP-seq
MIRT1050162	hsa-miR-548ae	CLIP-seq
MIRT1050163	hsa-miR-548aj	CLIP-seq
MIRT1050164	hsa-miR-548am	CLIP-seq
MIRT1050165	hsa-miR-548d-3p	CLIP-seq
MIRT1050166	hsa-miR-548x	CLIP-seq
MIRT1050167	hsa-miR-548z	CLIP-seq
MIRT1050168	hsa-miR-873	CLIP-seq
MIRT1050128	hsa-miR-1185	CLIP-seq
MIRT2437630	hsa-miR-3155	CLIP-seq
MIRT1050148	hsa-miR-4313	CLIP-seq
MIRT1050155	hsa-miR-4670-3p	CLIP-seq
MIRT1050168	hsa-miR-873	CLIP-seq
MIRT1050128	hsa-miR-1185	CLIP-seq
MIRT2546899	hsa-miR-1206	CLIP-seq
MIRT1050129	hsa-miR-1245b-5p	CLIP-seq
MIRT2546900	hsa-miR-1251	CLIP-seq
MIRT2546901	hsa-miR-1254	CLIP-seq
MIRT1050130	hsa-miR-128	CLIP-seq
MIRT1050131	hsa-miR-1295	CLIP-seq
MIRT2546902	hsa-miR-1306	CLIP-seq
MIRT2546903	hsa-miR-148a	CLIP-seq
MIRT2546904	hsa-miR-148b	CLIP-seq
MIRT2546905	hsa-miR-152	CLIP-seq
MIRT2546906	hsa-miR-2110	CLIP-seq
MIRT2546907	hsa-miR-218	CLIP-seq
MIRT2546908	hsa-miR-3116	CLIP-seq
MIRT2546909	hsa-miR-3123	CLIP-seq
MIRT2546910	hsa-miR-3140-3p	CLIP-seq
MIRT1050138	hsa-miR-3142	CLIP-seq
MIRT2546911	hsa-miR-3150a-3p	CLIP-seq
MIRT2437630	hsa-miR-3155	CLIP-seq
MIRT2546912	hsa-miR-3183	CLIP-seq
MIRT2546913	hsa-miR-3192	CLIP-seq
MIRT2546914	hsa-miR-3194-5p	CLIP-seq
MIRT2546915	hsa-miR-328	CLIP-seq
MIRT2546916	hsa-miR-3614-3p	CLIP-seq
MIRT1050141	hsa-miR-3687	CLIP-seq
MIRT2546917	hsa-miR-371b-3p	CLIP-seq
MIRT2546918	hsa-miR-3938	CLIP-seq
MIRT2546919	hsa-miR-4271	CLIP-seq
MIRT2546920	hsa-miR-4276	CLIP-seq
MIRT2546921	hsa-miR-4292	CLIP-seq
MIRT1050147	hsa-miR-4297	CLIP-seq
MIRT2546922	hsa-miR-4300	CLIP-seq
MIRT1050148	hsa-miR-4313	CLIP-seq
MIRT2546923	hsa-miR-4317	CLIP-seq
MIRT1050151	hsa-miR-4442	CLIP-seq
MIRT1050153	hsa-miR-4493	CLIP-seq
MIRT1050155	hsa-miR-4670-3p	CLIP-seq
MIRT1050156	hsa-miR-4717-5p	CLIP-seq
MIRT2546924	hsa-miR-4723-3p	CLIP-seq
MIRT2546925	hsa-miR-4725-3p	CLIP-seq
MIRT2546926	hsa-miR-4764-5p	CLIP-seq
MIRT2546927	hsa-miR-4766-5p	CLIP-seq
MIRT2546928	hsa-miR-4786-3p	CLIP-seq
MIRT2546929	hsa-miR-636	CLIP-seq
MIRT2546930	hsa-miR-642a	CLIP-seq
MIRT2546931	hsa-miR-661	CLIP-seq
MIRT2546932	hsa-miR-671-5p	CLIP-seq
MIRT1050168	hsa-miR-873	CLIP-seq
MIRT2546933	hsa-miR-920	CLIP-seq
MIRT1050128	hsa-miR-1185	CLIP-seq
MIRT2546899	hsa-miR-1206	CLIP-seq
MIRT1050129	hsa-miR-1245b-5p	CLIP-seq
MIRT2546900	hsa-miR-1251	CLIP-seq
MIRT2546901	hsa-miR-1254	CLIP-seq
MIRT1050130	hsa-miR-128	CLIP-seq
MIRT1050131	hsa-miR-1295	CLIP-seq
MIRT2546902	hsa-miR-1306	CLIP-seq
MIRT2546903	hsa-miR-148a	CLIP-seq
MIRT2546904	hsa-miR-148b	CLIP-seq
MIRT2546905	hsa-miR-152	CLIP-seq
MIRT2546906	hsa-miR-2110	CLIP-seq
MIRT2546907	hsa-miR-218	CLIP-seq
MIRT2546908	hsa-miR-3116	CLIP-seq
MIRT2546909	hsa-miR-3123	CLIP-seq
MIRT2546910	hsa-miR-3140-3p	CLIP-seq
MIRT1050138	hsa-miR-3142	CLIP-seq
MIRT2546911	hsa-miR-3150a-3p	CLIP-seq
MIRT2437630	hsa-miR-3155	CLIP-seq
MIRT2546912	hsa-miR-3183	CLIP-seq
MIRT2546913	hsa-miR-3192	CLIP-seq
MIRT2546914	hsa-miR-3194-5p	CLIP-seq
MIRT2546915	hsa-miR-328	CLIP-seq
MIRT2546916	hsa-miR-3614-3p	CLIP-seq
MIRT1050141	hsa-miR-3687	CLIP-seq
MIRT2546917	hsa-miR-371b-3p	CLIP-seq
MIRT2546918	hsa-miR-3938	CLIP-seq
MIRT2546919	hsa-miR-4271	CLIP-seq
MIRT2546920	hsa-miR-4276	CLIP-seq
MIRT2546921	hsa-miR-4292	CLIP-seq
MIRT1050147	hsa-miR-4297	CLIP-seq
MIRT2546922	hsa-miR-4300	CLIP-seq
MIRT1050148	hsa-miR-4313	CLIP-seq
MIRT2546923	hsa-miR-4317	CLIP-seq
MIRT1050151	hsa-miR-4442	CLIP-seq
MIRT1050153	hsa-miR-4493	CLIP-seq
MIRT1050155	hsa-miR-4670-3p	CLIP-seq
MIRT1050156	hsa-miR-4717-5p	CLIP-seq
MIRT2546924	hsa-miR-4723-3p	CLIP-seq
MIRT2546925	hsa-miR-4725-3p	CLIP-seq
MIRT2546926	hsa-miR-4764-5p	CLIP-seq
MIRT2546927	hsa-miR-4766-5p	CLIP-seq
MIRT2546928	hsa-miR-4786-3p	CLIP-seq
MIRT2546929	hsa-miR-636	CLIP-seq
MIRT2546930	hsa-miR-642a	CLIP-seq
MIRT2546931	hsa-miR-661	CLIP-seq
MIRT2546932	hsa-miR-671-5p	CLIP-seq
MIRT1050168	hsa-miR-873	CLIP-seq
MIRT2546933	hsa-miR-920	CLIP-seq

Show/Hide all (21)

Transcription factor	Regulation	Reference
AR	Activation	11965035
BACH1	Activation	17942419
BACH1	Repression	17409198;18550526;21982894
CREB1	Repression	14523007
ERG	Unknown	10022513
ETS1	Unknown	10022513
FLI1	Unknown	10022513
NFE2L2	Activation	16551619;21982894;22484158
NFE2L2	Repression	22459801
NFE2L2	Unknown	17942419;24035498
NFKB1	Unknown	8016102
PPARA	Unknown	17413033
PPARG	Unknown	17413033
RELA	Unknown	8016102
SMAD7	Unknown	11018038
SREBF1	Unknown	17452746
STAT1	Activation	19129475
STAT3	Activation	19129475
TFAP2A	Unknown	8016102
USF1	Activation	15242350
USF2	Activation	15242350

Show/Hide all (78)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	TAS	12239590
GO:0001935	Process	Endothelial cell proliferation	TAS	12239590
GO:0002246	Process	Wound healing involved in inflammatory response	IMP	9884342
GO:0002686	Process	Negative regulation of leukocyte migration	TAS	14525760
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IBA
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IDA	7703255, 17915953
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IEA
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IMP	11121422, 19556236
GO:0004392	Function	Heme oxygenase (decyclizing) activity	ISS
GO:0004392	Function	Heme oxygenase (decyclizing) activity	TAS	9884342
GO:0005198	Function	Structural molecule activity	IMP	19556236
GO:0005515	Function	Protein binding	IPI	21044950, 21597468, 32296183, 32353859, 32838362, 33060197, 35239449, 36217030
GO:0005615	Component	Extracellular space	TAS	18307065
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	19556236, 22503972
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005783	Component	Endoplasmic reticulum	TAS	3345742
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	22419571, 27184847
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IMP	19556236
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006788	Process	Heme oxidation	IBA
GO:0006788	Process	Heme oxidation	IDA	17915953
GO:0006788	Process	Heme oxidation	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IDA	17915953
GO:0006879	Process	Intracellular iron ion homeostasis	IMP	22989377
GO:0006915	Process	Apoptotic process	IEA
GO:0006979	Process	Response to oxidative stress	IBA
GO:0006979	Process	Response to oxidative stress	IMP	9884342
GO:0014806	Process	Smooth muscle hyperplasia	TAS	18289072
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3345742
GO:0016236	Process	Macroautophagy	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IEA
GO:0016242	Process	Negative regulation of macroautophagy	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019899	Function	Enzyme binding	ISS	15516695
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IDA	17915953
GO:0032722	Process	Positive regulation of chemokine production	TAS	17652371
GO:0034101	Process	Erythrocyte homeostasis	IMP	9884342
GO:0034383	Process	Low-density lipoprotein particle clearance	TAS	9884342
GO:0034605	Process	Cellular response to heat	IMP	21597468
GO:0035094	Process	Response to nicotine	IDA	18205746
GO:0035556	Process	Intracellular signal transduction	TAS	17652371
GO:0042167	Process	Heme catabolic process	IBA
GO:0042167	Process	Heme catabolic process	IDA	17915953
GO:0042167	Process	Heme catabolic process	IEA
GO:0042168	Process	Heme metabolic process	IEA
GO:0042542	Process	Response to hydrogen peroxide	ISS
GO:0042802	Function	Identical protein binding	IPI	19556236
GO:0042803	Function	Protein homodimerization activity	IDA	19556236
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0045765	Process	Regulation of angiogenesis	TAS	17652371
GO:0045766	Process	Positive regulation of angiogenesis	IDA	21788589
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22503972
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	17600318
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	17600318
GO:0060586	Process	Multicellular organismal-level iron ion homeostasis	IMP	9884342
GO:0071243	Process	Cellular response to arsenic-containing substance	IEA
GO:0071276	Process	Cellular response to cadmium ion	IEA
GO:0072719	Process	Cellular response to cisplatin	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IGI	24844779
GO:0110076	Process	Negative regulation of ferroptosis	IMP	26403645
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	18202225
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	24844779
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904037	Process	Positive regulation of epithelial cell apoptotic process	IEA

MIM	HGNC	e!Ensembl
141250	5013	ENSG00000100292

P09601

Protein name

Heme oxygenase 1 (HO-1) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 1 soluble form]

Protein function

[Heme oxygenase 1]: Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron (PubMed:11121422, Pu

PDB

1N3U , 1N45 , 1NI6 , 1OYK , 1OYL , 1OZE , 1OZL , 1OZR , 1OZW , 1S13 , 1S8C , 1T5P , 1TWN , 1TWR , 1XJZ , 1XK0 , 1XK1 , 1XK2 , 1XK3 , 3CZY , 3HOK , 3K4F , 3TGM , 4WD4 , 5BTQ , 6EHA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01126	Heme_oxygenase	11 → 216	Heme oxygenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level). {ECO:0000269|PubMed:20855888}.

Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Sequence length

288

Interactions

View interactions

	KEGG		Reactome
	Porphyrin metabolism Metabolic pathways HIF-1 signaling pathway Ferroptosis Mineral absorption Pathways in cancer MicroRNAs in cancer Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Heme degradation Interleukin-4 and Interleukin-13 signaling Iron uptake and transport Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Heme oxygenase 1 deficiency	Pathogenic; Likely pathogenic	rs747083748, rs756151512, rs1931525647, rs1931531888, rs2145766893, rs2517864138	RCV001543383 RCV001787239 RCV001787240 RCV001787241 RCV001787242 RCV000017242 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malignant tumor of esophagus	Pathogenic	rs747083748	RCV005914915	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Uterine carcinosarcoma	Pathogenic	rs747083748	RCV005914916	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (74)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HEMOLYTIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR COMPARTMENT SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD COAGULATION DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic obstructive pulmonary disease	Conflicting classifications of pathogenicity	ClinVar ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHRONIC PERSISTENT HEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPD, severe early onset	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY RESTENOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROPARESIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEME OXYGENASE-1 DEFICIENCY	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOPHILIA A	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HMOX1-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRON METABOLISM DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MASTOCYTOSIS, SYSTEMIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS, ALLERGIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 17	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR SYSTEM INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASOSPASM, INTRACRANIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (687)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	11144356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18786476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	21048024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	23092325, 27606430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	24681707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	24413389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	20966033, 25036905, 28836936, 30738992, 31210657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15688187, 17520317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19375813, 29537718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30122195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	15688187, 17520317, 26011642, 28521455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17558910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	CTD_human_DG	16319717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenomyeloneuropathy	Adrenomyeloneuropathy	CTD_human_DG	16319717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24681707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	11718997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22593583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21647550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Systemic Mastocytosis	Systemic Mastocytosis	CTD_human_DG	17420286		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	17593033		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	17593033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	15814490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19522732, 22549002, 30068908, 34837964, 36042609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	11144356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	11144356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	11144356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	11144356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	GENOMICS_ENGLAND_DG	21088618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28098243, 29090409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15870071, 23570271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	9349552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	12382200, 9884342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	18805612, 30046137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	15031206, 17593033, 20106603, 22966170, 26206798, 26315932, 28466968, 29437594, 33116199, 34496009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	30060095	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	CTD_human_DG	9884342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Hemolytic	Anemia	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Hemolytic, Acquired	Anemia	CTD_human_DG	9884342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Microangiopathic	Anemia	CTD_human_DG	9884342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11238038, 15031206, 17593033, 20306336, 21483798, 22966170, 26206798, 28466968, 29437594, 29694434, 30060095, 30898432, 31030250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	15869055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30653942, 31243599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome with Disordered Steroidogenesis	Antley-Bixler Syndrome	BEFREE	20732302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	39192217	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	12182912, 23430116, 28545777, 29743974, 31704097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	35915792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Diseases, Common Carotid	Moyamoya disease	CTD_human_DG	17095719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	29437594	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12182912, 14691581, 15031206, 16999951, 18289069, 18620357, 20704546, 20704550, 20796278, 21622183, 24056745, 24434148, 25016572, 25359861, 28970059 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28193225, 29149703, 29362850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	31120979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	19536150	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	28423042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16572448, 18050210, 33087158, 35759235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18975324, 29096690	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	31830562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18048809, 20599261, 20704548, 30333233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	18048809		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	18048809		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18048809	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	21531452, 21799075, 23893806, 35572500, 9828853	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma Occupational	Asthma	Pubtator	20345975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11746786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24234335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11278277	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	30085341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12118938, 12182912, 12805077, 16999951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12182912, 15031206, 15140586, 16999951, 18289069, 18620357, 20704546, 20704550, 20796278, 21622183, 24056745, 24434148, 25016572, 25359861, 28970059 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	16474202, 16582079	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17008602, 17341845, 17927807, 20796278, 24434148, 25359861, 40489880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	18375832, 23437133, 25268359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	23437133, 25268359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	34321570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22578957, 24766133, 28082120, 31288720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22578957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	17325212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	21556890		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28164440, 29328470, 30055129, 30673960, 31400930, 31441362, 31599449, 31660030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18234118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	18234118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	18234118	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	21750082	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	26377036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	32581238	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	22514698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	22139798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	CTD_human_DG	9884342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Bone disease	Pubtator	36967561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	34321570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	29991707, 34312792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16319139, 18483307, 19255063, 23347118, 24145726, 24180625, 28627599, 29339440, 30216645, 30238818, 30538554, 30764900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21136273, 23347118, 24180625, 24366869, 25813625, 26041409, 30216645, 31964465, 32168943, 32485912, 33294119, 33801351, 37827129	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	31211507	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	25751573, 26172140, 28667068, 30024305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	19423691	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	23293173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carbamoyl-Phosphate Synthase I Deficiency Disease	Carbamoyl Phosphate Synthase Deficiency	BEFREE	30337301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22490514, 28679437, 36691638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28679437, 29537718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35501667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22848562, 24098580, 27227932, 30057686, 31261522, 33378016, 34663301, 35866605, 36047102, 36189226, 36746728, 37008632, 37147523, 37330650, 38127054, 39795978, 9349552 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	31052354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18006113, 19375813, 20461740, 20704548, 22421218, 25661467, 28634389, 30538554, 31227482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26675757, 29930735, 31243599, 32629871, 37653101, 39740375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24636201, 34135317, 35396773, 35656025, 37031459, 40419510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36178067	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15365571, 35501667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	24892215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24247298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	15849452, 23437133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	23723143, 24813593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	38172743	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	25822459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16313248, 17822372, 18619522, 18786476, 19384082, 19389234, 20708634, 21091076, 23732814, 25187885, 25359861, 26483091, 27033195, 27312759, 28225026, 29354880, 31332605, 31644887 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19389234, 25359861, 26132561, 36012132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	17095719		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	BEFREE	19487598		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	Pubtator	20796278, 40489880	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	CTD_human_DG	17095719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	20796278, 30354985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	24075749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	29339024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	CTD_human_DG	10631150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	16455537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	35465695	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	10985695, 28672984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	20175935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	20175935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	11206713, 19686725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	18786476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	20175935, 25016572, 29298658, 30646866, 31030250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	16582079		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30745843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30745843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24681707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22593583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20938215, 22514698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20938215, 22514698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	17593033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	17593033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	30538149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	20667089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	20404253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26206798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18045827, 31239473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15817713, 17203192, 17254481, 17845132, 20704548, 21651746, 21721950, 21902835, 22201606, 22542718, 26674585, 27555763, 27998018, 28129777, 28588027 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	25511052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12891549, 28025064, 29877949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	18784349		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	19457088, 25111043, 25761244, 25820186, 28746897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	18980530, 29393366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	16882737, 25202977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28535981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19522732, 22549002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	CTD_human_DG	16365149, 21444764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	22409325, 23446334, 23494124, 28257879, 29518435, 30061089, 31704099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	15115285	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	20509889, 28770550, 33299870, 39252247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19833168, 22302482, 25876647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17558910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21191307, 22212955, 24743738, 24927633, 25574604, 26087182, 27999449, 30321531, 31112982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17558910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22302482, 25122478, 25431258, 27323826, 27999449, 30736789, 31199053, 36869896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29074106	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	CTD_human_DG	19171794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	20971094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of spleen	Asplenia	BEFREE	21088618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	22514698, 28732110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15797755, 17322421, 20404253, 24813593, 25822459, 31344980		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28724911, 30799949, 31186733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12136229, 12377749, 14691581, 15589739, 16020495, 16198853, 17541213, 18443197, 18620357, 19389234, 19676145, 20656217, 20708634, 20796278, 22120665 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	12136229		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	12136229, 12377749, 14691581, 15589739, 16020495, 18443197, 19389234, 19676145, 20175935, 20656217, 20708634, 20796278, 22120665, 23293173, 23602216 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	12136229, 12377749, 17541213, 18443197		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	12136229		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	18443197, 19389234, 20175935, 20796278, 22123460, 22780915, 23293173, 23602216, 24762402, 28444966	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	15869055	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	22120665	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27821168, 34980781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12136229, 12377749, 14691581, 15589739, 16020495, 18443197, 19389234, 19676145, 20656217, 20708634, 20796278, 22120665, 23293173, 23602216, 24670375, 24762402, 25187885, 27825138 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	12730098, 15028349, 20796278	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	20509889, 24407487, 30061089, 30258436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28770550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	15184199		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	23606537		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	28289476	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness	Deafness	Pubtator	15849452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	27557546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	10942521, 12709579, 15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	10942521, 12709579, 15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18077487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19428335, 28684418, 29138829, 29678719, 30240794, 30931327, 31410125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	34321570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	28543773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29662895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	21253390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	26824276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28342333, 31410134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	17620093, 26950613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	17620093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18582925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	17620093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	15899048	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15284058, 16759310, 17513461, 17883332, 17991645, 20539916, 23293173, 25475440, 25661467, 27274779, 28555162, 28642813, 29359167, 31108850, 31332605, 31751579 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35806251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15284058, 16759310, 17513461, 17883332, 17991645, 18620357, 20539916, 23293173, 25475440, 25661467, 27274779, 27738197, 28555162, 28642813, 29359167, 31108850, 31332605, 31751579 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15849452, 17991645, 18443197, 20796278, 22445099, 23293173, 26173399, 27274779, 37002266, 37414746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34682638	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17991645, 18229449, 25511473, 26512585, 27374075, 29752628, 37445792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34682638	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11899074, 28700700, 30987262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	12136229, 16123366, 16959961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12679469, 12941774, 16759310, 17991645, 18620357, 19696228, 20682519, 25511473, 26512585, 27374075, 27473828, 28684418, 28700700, 29082606, 29752628, 30865534 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17991645		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	CTD_human_DG	16959961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31100876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31467925, 36401196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26733347, 28543864, 29161661, 30128961, 30439604, 30865534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	30045011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36689408, 38084838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29108243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	9134328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	21088618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	25391381, 26513650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	20175935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	20175935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	30538149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	24485305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	27487831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	10631150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29510721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	29510721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous Hyperinsulinism	Endogenous Hyperinsulinism	CTD_human_DG	19171794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	31505119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11872213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	25772769, 30214615, 30567635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25772769, 33800989, 37555920, 38012607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	37946105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	37946105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	BEFREE	28569786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23919806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23919806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23919806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23919806, 34264023, 34999996, 36921563, 37312528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	BEFREE	22849380, 29877949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12872043, 19886851, 21275653, 31230554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	19886851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	26091465, 28276576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	26091465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exogenous Hyperinsulinism	Exogenous Hyperinsulinism	CTD_human_DG	19171794		★★★★★ ★☆☆☆☆ Found in Text Mining only
External Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	17095719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	11144356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	19808972, 21381033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	15763346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28298541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	15763346, 27935258, 31387260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19554654, 27960551, 29896252, 29957462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Emphysema	Emphysema	CTD_human_DG	10631150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29137483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	31712142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	17520317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	15115285, 25108023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	15115285	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	22090784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	20518085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19236506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	CTD_human_DG	20378827		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroparesis	Gastroparesis	BEFREE	29052298, 29161307, 29501441		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroparesis	Gastroparesis	Pubtator	29052298	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gilbert Disease	Gilbert syndrome	Pubtator	28389660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10349844, 16924499, 26011642, 28382863, 31282108, 8764571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10349844, 27354342, 28365151, 31282108, 36054818, 37382594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10349844, 16924499, 26011642, 28382863, 31282108, 8764571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17216339, 18937073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17216339, 24234335, 29938581, 36164395, 40495644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	19194559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	29137483	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	29137483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	27606430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	20971094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32098821	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	14587309	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	35035663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	14587309, 26968795, 27251503, 28186648, 37499888, 38172743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31731058	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	15797755, 17322421, 24813593, 25822459, 31344980		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	37499888	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28257621, 28756878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	25146616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	19508170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heme Oxygenase 1 Deficiency	Heme Oxygenase 1 Deficiency	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Heme oxygenase-1 deficiency	Heme Oxygenase 1 Deficiency	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemolysis	Hemolysis	Pubtator	21106538, 23100518, 29437594, 30046137	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	20106603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	23716558		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophilia A	Hemophilia a	Pubtator	23716558	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhage	Hemorrhage	Pubtator	21868703, 22052915, 27251503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24752012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31559456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	21253390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	CTD_human_DG	21253390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	14647439, 22490514		★★★★★ ★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	28257713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	23526486, 25912757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	23345623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	33738869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23345623, 29722329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	12736395, 17325212, 21198350, 23877636, 27557546, 27943244, 28389660, 29302043, 30205413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	Pubtator	27557546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia Neonatal	Hyperbilirubinemia	Pubtator	27557546, 30298137, 38279097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia, Neonatal	Hyperbilirubinemia	BEFREE	12736395, 17325212, 23877636, 27557546, 28206992, 30298137, 30700176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	12377749, 18620357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	LHGDN	12377749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperferritinemia	Hyperferritinemia	Pubtator	15899048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17883332, 19924377, 28287466, 29615440, 30046379, 31616304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19924377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31629034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	CTD_human_DG	19171794		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	BEFREE	15140586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35697922	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Portal	Portal hypertension	Pubtator	12166345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	LHGDN	17531161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12872043, 16860128, 18515325, 19027871, 19886851, 20957739, 21787712, 23391748, 23425954, 24553299, 26206798, 26512585, 26516175, 31410134, 9134328		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12872043		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	16959961, 22349312, 22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	25933176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30508596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	15849452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14615405, 16787441, 20197421, 33491566, 35417854, 36775962	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15211754, 16198853, 23455892, 24063008, 24114211, 35409364, 35833819, 37481543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20118244	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28781627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20704548, 20957739, 27470556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18216050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18216050	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	18045827, 19194559		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	19194559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	21842368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	26269184, 30302660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25114080, 27058954, 28535981, 29510721, 29662895, 30646866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Indolent Systemic Mastocytosis	Indolent Systemic Mastocytosis	CTD_human_DG	17420286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	21556890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11076874, 28770550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15115285, 28770550, 31284478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	17620093, 26950613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35806251, 37883387	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Internal Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	17095719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	26877238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26877238, 32015215, 36814575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28206713, 28293084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhage Traumatic	Intracranial hemorrhage	Pubtator	34312792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	19380867, 24963040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	CTD_human_DG	25247420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Metabolism Disorders	Iron Metabolism Disorders	CTD_human_DG	9884342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Iron Overload	Iron Overload	BEFREE	19777608, 28243792, 29111167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	34530349, 37726294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20175935, 20486808, 28780392, 30014798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	22338608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	14726403, 17881360, 26859574, 28421060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	30106111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36240204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	17258074, 18229449	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19194559, 24762402, 26512585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	24762402, 26206798, 26512585, 29476712, 30481230, 31216709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24762402, 26206798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	10807584, 11928711, 22495295, 25751573, 28139396, 28485784, 28515173, 29500224, 30084650, 30100067, 31001374, 31120979, 31313953, 31530210, 31771519		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	21048024		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	22622455		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	25822459, 26206798		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	BEFREE	20855888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	20855888, 21808062, 22843690, 23752066, 37898101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27840932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27400252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	11718997		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	11718997		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	11718997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	36749068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	35552484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17018862, 18024796, 20345481, 26870816, 27447561, 31231394, 33092263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19508170, 20618971, 27451975, 27606430, 28756878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18202225, 20345481, 21307400, 26218201, 27606430, 36890092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18202225, 20332229, 21307400, 21742584, 24413389, 25231232, 25585641, 25828744, 28756878, 29494986, 30623427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	27817989, 28576353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17095152, 25162226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12133007, 12469218, 18566988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15477009, 16951197, 27571925, 27740521, 29524413, 30055129, 30538554, 30606233, 31261522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12166345, 12891549, 21253390, 28025064, 29877949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	12166345, 16489673, 33333908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	35134262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	18972446	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	Pubtator	30057686, 38127054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	15547665, 28320485, 30528392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	LHGDN	15547665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15477009, 16951197		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	17002867		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	16980551, 20704548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23671613, 28289476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	18216050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	15688187, 18508827		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	18508827	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	24012673, 31227482, 32855269, 35898682, 37749553	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31921135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22338608, 22801788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	31921135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18492619, 25063314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22490514, 34264023	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	15899048	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	LHGDN	15899048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	29504848, 31231394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	21647550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	15530192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	22271370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16319139, 18483307, 19255063, 23347118, 24145726, 28627599, 29339440, 30216645, 30238818, 30538554, 30764900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23919806, 26916598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	21808062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	17002867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	15688187, 18508827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18006113, 19375813, 20461740, 20704548, 22421218, 25661467, 28634389, 30538554, 31227482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17095152, 25162226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19484149, 24247298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14517400, 15897578, 19508729, 21495030, 30653942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19808972, 19903769, 21381033, 21833623, 23226098, 23523860, 23591596, 24224047, 24247298, 24961479, 26418896, 28032857, 28512172, 30813528, 31137785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	25246272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	14647439, 22490514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17520317, 18502573, 22490514, 25956277, 29048628, 29537718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30149527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11011118, 14647439, 17520317, 19508729, 19808972, 20667089, 20704546, 20708634, 22689053, 23523860, 23591596, 24200599, 24247298, 24927633, 24931165 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	26801320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30745843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19833168, 22302482, 25876647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	24963040, 30337301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16319139, 17726138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29339440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	17420286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	CTD_human_DG	17420286		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	BEFREE	22593583		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11011118, 16596642, 22670665, 30231594, 30634993, 31376303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11011118, 20580464, 20667089, 21910007, 37176114, 9354392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16596642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22872370	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	30040951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28342333, 31410134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22019695, 22271370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25933176, 26471299, 28618991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	25933176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25933176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	38069389	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21725851, 25933176, 31425676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	20580464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathic hemolytic anemia	Microangiopathic hemolytic anemia	CTD_human_DG	9884342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	CTD_human_DG	16959961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22549002, 24440642, 27058954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30712660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19625608, 21910007, 26404762, 27322610, 28720798, 29938581, 30057686, 35268019, 36565570, 37726294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	31332208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	26868429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	16909019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	18205746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34769290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	12709585, 14521259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	12709585	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	26393425, 31052354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15725085, 22617388, 25341809, 26700310, 26795735, 26930712, 32298237, 36775962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22617388, 26795735, 28257621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18930811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25111043, 26868429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26868429, 30298137, 36595760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36565681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29669436		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	26782424, 31711520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27311589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15126353, 22139798, 24681707, 25146616, 25802333, 28257621, 28445830, 28978042, 30256411, 30261468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11827926, 15064108, 15797262, 15800659, 16449792, 17322421, 19389234, 22450704, 22776314, 23293173, 28534119, 29771427, 30527623, 31080351, 31228798, 31344980 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	19389234, 20175935, 23293173, 31731058, 37798364, 38253721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15064108, 16198853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	15064108		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	16198853, 34750390	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	24401606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy Central Core	Central core myopathy	Pubtator	23293173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18582367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18582367, 33589574, 35682782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	31767834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	25665053, 26426434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10378773, 11011118, 12151344, 15897578, 16906285, 17216339, 17520317, 17822372, 17881360, 20518085, 20667089, 20704546, 21168882, 21206978, 21381033 View all (41 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	21366594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29510721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	26173399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10681514, 19457084, 20028456, 21327520, 22142473, 23454680, 27023064, 28681934, 29526395, 29948946, 30327713, 30652259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24380881, 27023064, 9354392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	28543773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	10681514, 25202977	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10681514, 11053673, 19785642, 20704549, 25111043, 28070834, 28535981, 28900849, 30019638		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	10942521, 12709579, 15964507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21236443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	27817989, 28576353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	33498175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	15763346, 25835554, 31387260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	20971094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20618971, 21950555, 22418244, 23617628, 23707609, 27641735, 28749936, 30248308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	18334666, 18375438, 19171794		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	19687791, 26471299, 28243792, 28287466, 31425676		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	21947364, 27274779, 30024897	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	28283920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	24234335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	21556890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	30538149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	15725085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	19388153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23840483, 28237856, 29339024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	33355373	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	20020468, 28088947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	19853072, 19924377, 40517505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19924377, 28122344, 31004750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24676542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26283888, 32930133, 33453607, 33917440, 37285835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31121086		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24247298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39210460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	23226098, 24224047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panacinar Emphysema	Panacinar emphysema	CTD_human_DG	10631150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14517400, 15897578, 19508729, 21495030, 30653942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	CTD_human_DG	18784349		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26675757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15897578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	19508729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30057678, 35915609, 36497150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	18165777, 20966033, 22666428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36671463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	31210657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	24681779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	24681779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	17526019		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	19457084, 19475336, 19785642, 20039940, 20704549, 22513881, 23261939, 23454680, 25111043, 26091465, 28179208, 29429149, 29488275, 30040983, 31153970, 31180611, 31800144, 31847534, 9225984 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	21318773		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	26091465, 35802825	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	21366594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	29488275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	18799798, 30040983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	26675757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	31586635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	25511052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	17924972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	33917440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	12182912, 30159103, 31344980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	20175935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	20971094		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29259392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30628648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	17919067		★★★★★ ★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	20526373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	18045827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31772710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31772710, 37883387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	15899048	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	12166345, 28025064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	LHGDN	15849554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31293390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31264739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	24681707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	11144356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29662895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	28229933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	29259392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19808972, 19903769, 21381033, 21833623, 23226098, 23523860, 23591596, 24224047, 24247298, 24961479, 26418896, 28032857, 28512172, 30813528, 31137785, 31810001 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	8650873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	26418896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18026199, 23591596, 32640729, 32930133, 34375508	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	25246272		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Protoporphyria Erythropoietic	Erythropoietic protoporphyria	Pubtator	27257045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17620093, 22965812, 29980703, 30301214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	29980703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	30301214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12797490, 28588027, 32000766	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16882737, 26674585, 30341816, 31411335, 31564855, 32321531, 35441963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27555763	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	10631150, 12730098, 19822148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	CTD_human_DG	10631150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	30333233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	15814490		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24854244, 29362432		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	36565570	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	29991707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	21808062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24636201, 28724911, 31186733, 8913885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	19194559, 21787712, 24642709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	18301921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	18301921, 19526221, 28870868, 29849835, 30024305, 30362554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	18301921, 26172140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	26488115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	26313808, 29033051, 30311259, 31063999, 31092216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	26313808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	CTD_human_DG	23075401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	24069283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	26172140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	27488535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18050210, 18975324, 20597111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18050210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	LHGDN	16540907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	36127783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	20957739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	14726403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22875919, 28603087, 28746897, 30948194, 31847534		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22875919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	29991707	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	38166692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	11053673, 19457088, 27058954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	15530192, 18060048, 18981090, 21083424, 21454555, 23042203, 23521418, 24201221, 24474616, 26253656, 27454382, 28082120, 28350760, 28368519, 29170136 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30159112	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	18980530, 29393366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28283920, 30159112		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30122195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	26173399		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	24413982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	CTD_human_DG	24413982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	35784335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	20526373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10378773, 15365571, 18312299, 22580187, 24969894, 25912757, 26801320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15365571, 16387424, 18272347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19895178, 23919806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15365571, 27840932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18492619	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35682782	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22580187, 28367064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	20971094		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	29131354		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	20971094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15763346, 28298541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17520317, 18502573, 22490514, 25956277, 29048628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14647439, 18502573		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	14647439, 22490514		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	22490514, 25956277, 28679437, 31151932, 35237380, 35417854	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	20175935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	11206713, 19686725, 27896625, 29563984, 30240794, 31635102, 31675694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	25114080		★★★★★ ★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	24474616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	24145726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	18201862	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	30871975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	36691638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30149527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30149527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	35806120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	21206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	26337933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid valve disease	Pubtator	26337933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37664913, 38012585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15115285, 19120903, 20509889, 30061089, 30258436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unconjugated hyperbilirubinemia	Hyperbilirubinemia	BEFREE	20121710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	22440905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25063314, 36584429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	21206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	29510721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30745843, 38031977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	33678318, 37773689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	28684304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	LHGDN	15878918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	16210136, 18289069, 19036700, 20704550, 21091076, 25475440, 25955183, 28186648, 29359167, 31425676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	17823375, 26968795, 31230554, 38069389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	17896171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	37499888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	34312792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	18201862, 22959128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	33410147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	16198853	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	21426408, 27222475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	21426408, 24662764, 25029322, 27222475, 29974998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	21426408, 27222475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	38180775	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HMOX1 (heme oxygenase 1)