HMGB2 (high mobility group box 2)

Gene

• Entrez ID: 3148
• Gene name: High mobility group box 2
• Gene symbol: HMGB2
• Synonyms (NCBI Gene): HMG2
• Chromosome: 4
• Chromosome location: 4q34.1
• Summary: This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025152	hsa-miR-181a-5p	Microarray	17612493
MIRT028203	hsa-miR-33a-5p	Sequencing	20371350
MIRT030580	hsa-miR-24-3p	Microarray	19748357
MIRT044016	hsa-miR-374a-5p	CLASH	23622248
MIRT438692	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23986579
MIRT438323	hsa-miR-23b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25996293
MIRT438323	hsa-miR-23b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25996293
MIRT438692	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23986579
MIRT438323	hsa-miR-23b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25996293
MIRT438323	hsa-miR-23b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25996293
MIRT511516	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT511527	hsa-miR-8485	HITS-CLIP	21572407
MIRT511526	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT511525	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT511524	hsa-miR-603	HITS-CLIP	21572407
MIRT511523	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT511522	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT511521	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT523162	hsa-miR-1228-3p	HITS-CLIP	21572407
MIRT523161	hsa-miR-3622a-3p	HITS-CLIP	21572407
MIRT523160	hsa-miR-3622b-3p	HITS-CLIP	21572407
MIRT523159	hsa-miR-544b	HITS-CLIP	21572407
MIRT511520	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT511519	hsa-miR-3941	HITS-CLIP	21572407
MIRT511518	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT511517	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT542934	hsa-miR-3924	HITS-CLIP	21572407
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT475608	hsa-miR-23c	PAR-CLIP	20371350
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT475602	hsa-miR-4461	PAR-CLIP	20371350
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	20371350
MIRT475600	hsa-miR-3928-5p	PAR-CLIP	20371350
MIRT475599	hsa-miR-6806-3p	PAR-CLIP	20371350
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT475597	hsa-miR-558	PAR-CLIP	20371350
MIRT475596	hsa-miR-4487	PAR-CLIP	20371350
MIRT475594	hsa-miR-127-5p	PAR-CLIP	20371350
MIRT475593	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT093569	hsa-miR-4452	PAR-CLIP	20371350
MIRT475592	hsa-miR-4325	PAR-CLIP	20371350
MIRT574709	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT574708	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT574707	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT562224	hsa-miR-3609	PAR-CLIP	20371350
MIRT562223	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT562222	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT562221	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT562220	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT562219	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT562218	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT562217	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT562216	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT562215	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT562214	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT562213	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT562210	hsa-miR-3119	PAR-CLIP	20371350
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT475608	hsa-miR-23c	PAR-CLIP	20371350
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT309701	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT567325	hsa-miR-300	PAR-CLIP	20371350
MIRT567324	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT567323	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT475605	hsa-miR-302f	PAR-CLIP	20371350
MIRT475604	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT475603	hsa-miR-548p	PAR-CLIP	20371350
MIRT475602	hsa-miR-4461	PAR-CLIP	20371350
MIRT371053	hsa-miR-4328	PAR-CLIP	20371350
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	20371350
MIRT475600	hsa-miR-3928-5p	PAR-CLIP	20371350
MIRT475599	hsa-miR-6806-3p	PAR-CLIP	20371350
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT475597	hsa-miR-558	PAR-CLIP	20371350
MIRT475596	hsa-miR-4487	PAR-CLIP	20371350
MIRT356124	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT475595	hsa-miR-4766-3p	PAR-CLIP	20371350
MIRT567322	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT567321	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT567320	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT567319	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT475594	hsa-miR-127-5p	PAR-CLIP	20371350
MIRT475593	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT093569	hsa-miR-4452	PAR-CLIP	20371350
MIRT475592	hsa-miR-4325	PAR-CLIP	20371350
MIRT475591	hsa-miR-6894-3p	PAR-CLIP	20371350
MIRT475590	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT356148	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT356151	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT562224	hsa-miR-3609	PAR-CLIP	20371350
MIRT562223	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT562222	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT562221	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT562220	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT562219	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT562218	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT562217	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT562216	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT562215	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT562214	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT562213	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT562212	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT562211	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT562210	hsa-miR-3119	PAR-CLIP	20371350
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT475608	hsa-miR-23c	PAR-CLIP	20371350
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT475605	hsa-miR-302f	PAR-CLIP	20371350
MIRT475603	hsa-miR-548p	PAR-CLIP	20371350
MIRT475602	hsa-miR-4461	PAR-CLIP	20371350
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	20371350
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT475597	hsa-miR-558	PAR-CLIP	20371350
MIRT475596	hsa-miR-4487	PAR-CLIP	20371350
MIRT356124	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT475595	hsa-miR-4766-3p	PAR-CLIP	20371350
MIRT475593	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT093569	hsa-miR-4452	PAR-CLIP	20371350
MIRT475592	hsa-miR-4325	PAR-CLIP	20371350
MIRT475591	hsa-miR-6894-3p	PAR-CLIP	20371350
MIRT475590	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT562239	hsa-miR-548n	PAR-CLIP	20371350
MIRT562238	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT562237	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT562236	hsa-miR-548l	PAR-CLIP	20371350
MIRT562235	hsa-miR-4797-5p	PAR-CLIP	20371350
MIRT562234	hsa-miR-3123	PAR-CLIP	20371350
MIRT562233	hsa-miR-3919	PAR-CLIP	20371350
MIRT562232	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT562231	hsa-miR-139-5p	PAR-CLIP	20371350
MIRT562230	hsa-miR-20a-3p	PAR-CLIP	20371350
MIRT562229	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT562228	hsa-miR-4684-5p	PAR-CLIP	20371350
MIRT562227	hsa-miR-4768-5p	PAR-CLIP	20371350
MIRT562226	hsa-miR-6833-3p	PAR-CLIP	20371350
MIRT562225	hsa-miR-6809-3p	PAR-CLIP	20371350
MIRT562224	hsa-miR-3609	PAR-CLIP	20371350
MIRT562223	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT562222	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT562221	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT562220	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT562219	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT562218	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT562217	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT562216	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT562215	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT562214	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT562213	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT562212	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT562211	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT562210	hsa-miR-3119	PAR-CLIP	20371350
MIRT511527	hsa-miR-8485	PAR-CLIP	21572407
MIRT511526	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT511525	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT511524	hsa-miR-603	PAR-CLIP	21572407
MIRT511523	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT511521	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523162	hsa-miR-1228-3p	PAR-CLIP	21572407
MIRT523161	hsa-miR-3622a-3p	PAR-CLIP	21572407
MIRT523160	hsa-miR-3622b-3p	PAR-CLIP	21572407
MIRT523159	hsa-miR-544b	PAR-CLIP	21572407
MIRT511520	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT511519	hsa-miR-3941	PAR-CLIP	21572407
MIRT511518	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542934	hsa-miR-3924	PAR-CLIP	21572407
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT511521	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT511520	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542934	hsa-miR-3924	PAR-CLIP	21572407
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT511526	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT511525	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT511524	hsa-miR-603	PAR-CLIP	21572407
MIRT511523	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT511521	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523162	hsa-miR-1228-3p	PAR-CLIP	21572407
MIRT523161	hsa-miR-3622a-3p	PAR-CLIP	21572407
MIRT523160	hsa-miR-3622b-3p	PAR-CLIP	21572407
MIRT511520	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT511519	hsa-miR-3941	PAR-CLIP	21572407
MIRT511518	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542934	hsa-miR-3924	PAR-CLIP	21572407
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511526	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT511525	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT511524	hsa-miR-603	PAR-CLIP	23446348
MIRT511523	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511521	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT523162	hsa-miR-1228-3p	PAR-CLIP	23446348
MIRT523161	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT523160	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT523159	hsa-miR-544b	PAR-CLIP	23446348
MIRT511520	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT511519	hsa-miR-3941	PAR-CLIP	23446348
MIRT511518	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT511527	hsa-miR-8485	PAR-CLIP	23446348
MIRT511526	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT511525	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT511524	hsa-miR-603	PAR-CLIP	23446348
MIRT511523	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511521	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT511520	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT511519	hsa-miR-3941	PAR-CLIP	23446348
MIRT511518	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	23592263
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	23592263
MIRT475608	hsa-miR-23c	PAR-CLIP	23592263
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	23592263
MIRT309701	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT475606	hsa-miR-5692a	PAR-CLIP	23592263
MIRT475605	hsa-miR-302f	PAR-CLIP	23592263
MIRT475604	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT475603	hsa-miR-548p	PAR-CLIP	23592263
MIRT475602	hsa-miR-4461	PAR-CLIP	23592263
MIRT371053	hsa-miR-4328	PAR-CLIP	23592263
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	23592263
MIRT475600	hsa-miR-3928-5p	PAR-CLIP	23592263
MIRT475599	hsa-miR-6806-3p	PAR-CLIP	23592263
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT475597	hsa-miR-558	PAR-CLIP	23592263
MIRT475596	hsa-miR-4487	PAR-CLIP	23592263
MIRT356124	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT475595	hsa-miR-4766-3p	PAR-CLIP	23592263
MIRT475594	hsa-miR-127-5p	PAR-CLIP	23592263
MIRT475593	hsa-miR-183-3p	PAR-CLIP	23592263
MIRT093569	hsa-miR-4452	PAR-CLIP	23592263
MIRT475592	hsa-miR-4325	PAR-CLIP	23592263
MIRT475591	hsa-miR-6894-3p	PAR-CLIP	23592263
MIRT475590	hsa-miR-6514-3p	PAR-CLIP	23592263
MIRT356148	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT356151	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT440494	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440494	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	26701625
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	26701625
MIRT356124	hsa-miR-1468-3p	PAR-CLIP	26701625
MIRT356124	hsa-miR-1468-3p	PAR-CLIP	26701625
MIRT475593	hsa-miR-183-3p	PAR-CLIP	26701625
MIRT475593	hsa-miR-183-3p	PAR-CLIP	26701625
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	26701625
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	26701625
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	26701625
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	26701625
MIRT475608	hsa-miR-23c	PAR-CLIP	26701625
MIRT475608	hsa-miR-23c	PAR-CLIP	26701625
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT475592	hsa-miR-4325	PAR-CLIP	26701625
MIRT475592	hsa-miR-4325	PAR-CLIP	26701625
MIRT093569	hsa-miR-4452	PAR-CLIP	26701625
MIRT093569	hsa-miR-4452	PAR-CLIP	26701625
MIRT475602	hsa-miR-4461	PAR-CLIP	26701625
MIRT475602	hsa-miR-4461	PAR-CLIP	26701625
MIRT475596	hsa-miR-4487	PAR-CLIP	26701625
MIRT475596	hsa-miR-4487	PAR-CLIP	26701625
MIRT475595	hsa-miR-4766-3p	PAR-CLIP	26701625
MIRT475595	hsa-miR-4766-3p	PAR-CLIP	26701625
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	26701625
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	26701625
MIRT475603	hsa-miR-548p	PAR-CLIP	26701625
MIRT475603	hsa-miR-548p	PAR-CLIP	26701625
MIRT475597	hsa-miR-558	PAR-CLIP	26701625
MIRT475597	hsa-miR-558	PAR-CLIP	26701625
MIRT735998	hsa-miR-590-3p	Microarray	31557418
MIRT475594	hsa-miR-127-5p	Luciferase reporter assay, Western blotting	32391592
MIRT511516	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT511527	hsa-miR-8485	HITS-CLIP	21572407
MIRT511526	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT511525	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT511524	hsa-miR-603	HITS-CLIP	21572407
MIRT511523	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT511522	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT511521	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT523162	hsa-miR-1228-3p	HITS-CLIP	21572407
MIRT523161	hsa-miR-3622a-3p	HITS-CLIP	21572407
MIRT523160	hsa-miR-3622b-3p	HITS-CLIP	21572407
MIRT523159	hsa-miR-544b	HITS-CLIP	21572407
MIRT511520	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT511519	hsa-miR-3941	HITS-CLIP	21572407
MIRT511518	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT511517	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT542934	hsa-miR-3924	HITS-CLIP	21572407
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT475608	hsa-miR-23c	PAR-CLIP	20371350
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT475602	hsa-miR-4461	PAR-CLIP	20371350
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	20371350
MIRT475600	hsa-miR-3928-5p	PAR-CLIP	20371350
MIRT475599	hsa-miR-6806-3p	PAR-CLIP	20371350
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT475597	hsa-miR-558	PAR-CLIP	20371350
MIRT475596	hsa-miR-4487	PAR-CLIP	20371350
MIRT475594	hsa-miR-127-5p	PAR-CLIP	20371350
MIRT475593	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT093569	hsa-miR-4452	PAR-CLIP	20371350
MIRT475592	hsa-miR-4325	PAR-CLIP	20371350
MIRT574709	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT574708	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT574707	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT562224	hsa-miR-3609	PAR-CLIP	20371350
MIRT562223	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT562222	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT562221	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT562220	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT562219	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT562218	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT562217	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT562216	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT562215	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT562214	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT562213	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT562210	hsa-miR-3119	PAR-CLIP	20371350
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT475608	hsa-miR-23c	PAR-CLIP	20371350
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT309701	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT567325	hsa-miR-300	PAR-CLIP	20371350
MIRT567324	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT567323	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT475605	hsa-miR-302f	PAR-CLIP	20371350
MIRT475604	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT475603	hsa-miR-548p	PAR-CLIP	20371350
MIRT475602	hsa-miR-4461	PAR-CLIP	20371350
MIRT371053	hsa-miR-4328	PAR-CLIP	20371350
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	20371350
MIRT475600	hsa-miR-3928-5p	PAR-CLIP	20371350
MIRT475599	hsa-miR-6806-3p	PAR-CLIP	20371350
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT475597	hsa-miR-558	PAR-CLIP	20371350
MIRT475596	hsa-miR-4487	PAR-CLIP	20371350
MIRT356124	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT475595	hsa-miR-4766-3p	PAR-CLIP	20371350
MIRT567322	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT567321	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT567320	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT567319	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT475594	hsa-miR-127-5p	PAR-CLIP	20371350
MIRT475593	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT093569	hsa-miR-4452	PAR-CLIP	20371350
MIRT475592	hsa-miR-4325	PAR-CLIP	20371350
MIRT475591	hsa-miR-6894-3p	PAR-CLIP	20371350
MIRT475590	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT356148	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT356151	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT562224	hsa-miR-3609	PAR-CLIP	20371350
MIRT562223	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT562222	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT562221	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT562220	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT562219	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT562218	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT562217	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT562216	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT562215	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT562214	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT562213	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT562212	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT562211	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT562210	hsa-miR-3119	PAR-CLIP	20371350
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT475608	hsa-miR-23c	PAR-CLIP	20371350
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT475605	hsa-miR-302f	PAR-CLIP	20371350
MIRT475603	hsa-miR-548p	PAR-CLIP	20371350
MIRT475602	hsa-miR-4461	PAR-CLIP	20371350
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	20371350
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT475597	hsa-miR-558	PAR-CLIP	20371350
MIRT475596	hsa-miR-4487	PAR-CLIP	20371350
MIRT356124	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT475595	hsa-miR-4766-3p	PAR-CLIP	20371350
MIRT475593	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT093569	hsa-miR-4452	PAR-CLIP	20371350
MIRT475592	hsa-miR-4325	PAR-CLIP	20371350
MIRT475591	hsa-miR-6894-3p	PAR-CLIP	20371350
MIRT475590	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT562239	hsa-miR-548n	PAR-CLIP	20371350
MIRT562238	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT562237	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT562236	hsa-miR-548l	PAR-CLIP	20371350
MIRT562235	hsa-miR-4797-5p	PAR-CLIP	20371350
MIRT562234	hsa-miR-3123	PAR-CLIP	20371350
MIRT562233	hsa-miR-3919	PAR-CLIP	20371350
MIRT562232	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT562231	hsa-miR-139-5p	PAR-CLIP	20371350
MIRT562230	hsa-miR-20a-3p	PAR-CLIP	20371350
MIRT562229	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT562228	hsa-miR-4684-5p	PAR-CLIP	20371350
MIRT562227	hsa-miR-4768-5p	PAR-CLIP	20371350
MIRT562226	hsa-miR-6833-3p	PAR-CLIP	20371350
MIRT562225	hsa-miR-6809-3p	PAR-CLIP	20371350
MIRT562224	hsa-miR-3609	PAR-CLIP	20371350
MIRT562223	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT562222	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT562221	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT562220	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT562219	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT562218	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT562217	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT562216	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT562215	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT562214	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT562213	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT562212	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT562211	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT562210	hsa-miR-3119	PAR-CLIP	20371350
MIRT511527	hsa-miR-8485	PAR-CLIP	21572407
MIRT511526	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT511525	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT511524	hsa-miR-603	PAR-CLIP	21572407
MIRT511523	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT511521	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523162	hsa-miR-1228-3p	PAR-CLIP	21572407
MIRT523161	hsa-miR-3622a-3p	PAR-CLIP	21572407
MIRT523160	hsa-miR-3622b-3p	PAR-CLIP	21572407
MIRT523159	hsa-miR-544b	PAR-CLIP	21572407
MIRT511520	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT511519	hsa-miR-3941	PAR-CLIP	21572407
MIRT511518	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542934	hsa-miR-3924	PAR-CLIP	21572407
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT511521	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT511520	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542934	hsa-miR-3924	PAR-CLIP	21572407
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT511526	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT511525	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT511524	hsa-miR-603	PAR-CLIP	21572407
MIRT511523	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT511521	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523162	hsa-miR-1228-3p	PAR-CLIP	21572407
MIRT523161	hsa-miR-3622a-3p	PAR-CLIP	21572407
MIRT523160	hsa-miR-3622b-3p	PAR-CLIP	21572407
MIRT511520	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT511519	hsa-miR-3941	PAR-CLIP	21572407
MIRT511518	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542934	hsa-miR-3924	PAR-CLIP	21572407
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511526	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT511525	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT511524	hsa-miR-603	PAR-CLIP	23446348
MIRT511523	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511521	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT523162	hsa-miR-1228-3p	PAR-CLIP	23446348
MIRT523161	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT523160	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT523159	hsa-miR-544b	PAR-CLIP	23446348
MIRT511520	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT511519	hsa-miR-3941	PAR-CLIP	23446348
MIRT511518	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT511527	hsa-miR-8485	PAR-CLIP	23446348
MIRT511526	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT511525	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT511524	hsa-miR-603	PAR-CLIP	23446348
MIRT511523	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT511522	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511521	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT511520	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT511519	hsa-miR-3941	PAR-CLIP	23446348
MIRT511518	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT511517	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT511516	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT438692	hsa-miR-23a-3p	PAR-CLIP	23592263
MIRT438323	hsa-miR-23b-3p	PAR-CLIP	23592263
MIRT475608	hsa-miR-23c	PAR-CLIP	23592263
MIRT475607	hsa-miR-130a-5p	PAR-CLIP	23592263
MIRT309701	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT475606	hsa-miR-5692a	PAR-CLIP	23592263
MIRT475605	hsa-miR-302f	PAR-CLIP	23592263
MIRT475604	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT475603	hsa-miR-548p	PAR-CLIP	23592263
MIRT475602	hsa-miR-4461	PAR-CLIP	23592263
MIRT371053	hsa-miR-4328	PAR-CLIP	23592263
MIRT475601	hsa-miR-4793-3p	PAR-CLIP	23592263
MIRT475600	hsa-miR-3928-5p	PAR-CLIP	23592263
MIRT475599	hsa-miR-6806-3p	PAR-CLIP	23592263
MIRT475598	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT475597	hsa-miR-558	PAR-CLIP	23592263
MIRT475596	hsa-miR-4487	PAR-CLIP	23592263
MIRT356124	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT475595	hsa-miR-4766-3p	PAR-CLIP	23592263
MIRT475594	hsa-miR-127-5p	PAR-CLIP	23592263
MIRT475593	hsa-miR-183-3p	PAR-CLIP	23592263
MIRT093569	hsa-miR-4452	PAR-CLIP	23592263
MIRT475592	hsa-miR-4325	PAR-CLIP	23592263
MIRT475591	hsa-miR-6894-3p	PAR-CLIP	23592263
MIRT475590	hsa-miR-6514-3p	PAR-CLIP	23592263
MIRT356148	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT356151	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT755515	hsa-miR-490-3p	Luciferase reporter assay	36445573
MIRT1049252	hsa-miR-1284	CLIP-seq
MIRT1049253	hsa-miR-181a	CLIP-seq
MIRT1049254	hsa-miR-181b	CLIP-seq
MIRT1049255	hsa-miR-181c	CLIP-seq
MIRT1049256	hsa-miR-181d	CLIP-seq
MIRT1049257	hsa-miR-23a	CLIP-seq
MIRT1049258	hsa-miR-23b	CLIP-seq
MIRT1049259	hsa-miR-3607-3p	CLIP-seq
MIRT1049260	hsa-miR-3663-3p	CLIP-seq
MIRT1049261	hsa-miR-3692	CLIP-seq
MIRT1049262	hsa-miR-381	CLIP-seq
MIRT1049263	hsa-miR-3914	CLIP-seq
MIRT1049264	hsa-miR-421	CLIP-seq
MIRT1049265	hsa-miR-4262	CLIP-seq
MIRT1049266	hsa-miR-4272	CLIP-seq
MIRT1049267	hsa-miR-4666-3p	CLIP-seq
MIRT1049268	hsa-miR-543	CLIP-seq
MIRT1049269	hsa-miR-651	CLIP-seq
MIRT1049270	hsa-miR-106a	CLIP-seq
MIRT1049271	hsa-miR-106b	CLIP-seq
MIRT1049252	hsa-miR-1284	CLIP-seq
MIRT1049272	hsa-miR-17	CLIP-seq
MIRT1049253	hsa-miR-181a	CLIP-seq
MIRT1049254	hsa-miR-181b	CLIP-seq
MIRT1049255	hsa-miR-181c	CLIP-seq
MIRT1049256	hsa-miR-181d	CLIP-seq
MIRT1049273	hsa-miR-20a	CLIP-seq
MIRT1049274	hsa-miR-20b	CLIP-seq
MIRT1049257	hsa-miR-23a	CLIP-seq
MIRT1049258	hsa-miR-23b	CLIP-seq
MIRT1049259	hsa-miR-3607-3p	CLIP-seq
MIRT1049275	hsa-miR-361-5p	CLIP-seq
MIRT1049276	hsa-miR-3647-3p	CLIP-seq
MIRT1049262	hsa-miR-381	CLIP-seq
MIRT1049263	hsa-miR-3914	CLIP-seq
MIRT1049264	hsa-miR-421	CLIP-seq
MIRT1049265	hsa-miR-4262	CLIP-seq
MIRT1049266	hsa-miR-4272	CLIP-seq
MIRT1049267	hsa-miR-4666-3p	CLIP-seq
MIRT1049277	hsa-miR-519d	CLIP-seq
MIRT1049268	hsa-miR-543	CLIP-seq
MIRT1049278	hsa-miR-548ah	CLIP-seq
MIRT1049279	hsa-miR-548t	CLIP-seq
MIRT1049269	hsa-miR-651	CLIP-seq
MIRT1049280	hsa-miR-93	CLIP-seq
MIRT1049252	hsa-miR-1284	CLIP-seq
MIRT1049257	hsa-miR-23a	CLIP-seq
MIRT1049258	hsa-miR-23b	CLIP-seq
MIRT1049259	hsa-miR-3607-3p	CLIP-seq
MIRT1049260	hsa-miR-3663-3p	CLIP-seq
MIRT2011294	hsa-miR-3685	CLIP-seq
MIRT1049261	hsa-miR-3692	CLIP-seq
MIRT1049262	hsa-miR-381	CLIP-seq
MIRT1049267	hsa-miR-4666-3p	CLIP-seq
MIRT1049252	hsa-miR-1284	CLIP-seq
MIRT1049253	hsa-miR-181a	CLIP-seq
MIRT1049254	hsa-miR-181b	CLIP-seq
MIRT1049255	hsa-miR-181c	CLIP-seq
MIRT1049256	hsa-miR-181d	CLIP-seq
MIRT1049257	hsa-miR-23a	CLIP-seq
MIRT1049258	hsa-miR-23b	CLIP-seq
MIRT1049259	hsa-miR-3607-3p	CLIP-seq
MIRT1049275	hsa-miR-361-5p	CLIP-seq
MIRT1049260	hsa-miR-3663-3p	CLIP-seq
MIRT1049262	hsa-miR-381	CLIP-seq
MIRT1049263	hsa-miR-3914	CLIP-seq
MIRT1049264	hsa-miR-421	CLIP-seq
MIRT1049265	hsa-miR-4262	CLIP-seq
MIRT1049266	hsa-miR-4272	CLIP-seq
MIRT1049267	hsa-miR-4666-3p	CLIP-seq
MIRT2243487	hsa-miR-4731-3p	CLIP-seq
MIRT2243488	hsa-miR-4801	CLIP-seq
MIRT1049268	hsa-miR-543	CLIP-seq
MIRT2243489	hsa-miR-548aa	CLIP-seq
MIRT2243490	hsa-miR-548ac	CLIP-seq
MIRT2243491	hsa-miR-548d-3p	CLIP-seq
MIRT1049279	hsa-miR-548t	CLIP-seq
MIRT2243492	hsa-miR-548z	CLIP-seq
MIRT1049269	hsa-miR-651	CLIP-seq
MIRT1049252	hsa-miR-1284	CLIP-seq
MIRT1049257	hsa-miR-23a	CLIP-seq
MIRT1049258	hsa-miR-23b	CLIP-seq
MIRT1049275	hsa-miR-361-5p	CLIP-seq
MIRT1049260	hsa-miR-3663-3p	CLIP-seq
MIRT1049262	hsa-miR-381	CLIP-seq
MIRT1049267	hsa-miR-4666-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11748232
GO:0000400	Function	Four-way junction DNA binding	ISS
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISS
GO:0000793	Component	Condensed chromosome	IDA	12925773
GO:0000793	Component	Condensed chromosome	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19965638
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	ISS
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	19811285
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002437	Process	Inflammatory response to antigenic stimulus	IEA
GO:0002437	Process	Inflammatory response to antigenic stimulus	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	11909973
GO:0003684	Function	Damaged DNA binding	IDA	8226934
GO:0003684	Function	Damaged DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	ISS
GO:0003697	Function	Single-stranded DNA binding	ISS
GO:0003713	Function	Transcription coactivator activity	IDA	19223331
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	9636147, 11909973, 25416956, 29721183, 31515488, 31694235, 32296183, 32867128
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	19811285
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8339930, 11909973
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	11909973
GO:0005737	Component	Cytoplasm	IEA
GO:0006265	Process	DNA topological change	ISS
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	ISS
GO:0006310	Process	DNA recombination	IEA
GO:0006325	Process	Chromatin organization	NAS	11909973
GO:0006334	Process	Nucleosome assembly	NAS	11909973
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	7797075
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007289	Process	Spermatid nucleus differentiation	IEA
GO:0008134	Function	Transcription factor binding	ISS
GO:0008301	Function	DNA binding, bending	IDA	8339930, 11909973
GO:0008584	Process	Male gonad development	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0032392	Process	DNA geometric change	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032991	Component	Protein-containing complex	IDA	11909973
GO:0033151	Process	V(D)J recombination	ISS
GO:0042056	Function	Chemoattractant activity	IDA	19811285
GO:0044378	Function	Non-sequence-specific DNA binding, bending	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	19965638
GO:0045654	Process	Positive regulation of megakaryocyte differentiation	IMP	19965638
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9636147
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	19965638
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19223331, 19965638
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	9010268, 11909973
GO:0048545	Process	Response to steroid hormone	IEA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050767	Process	Regulation of neurogenesis	ISS
GO:0050786	Function	RAGE receptor binding	IGI	19811285
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	23877675
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	23877675
GO:0050918	Process	Positive chemotaxis	IEA
GO:0060326	Process	Cell chemotaxis	IDA	19811285
GO:0071222	Process	Cellular response to lipopolysaccharide	IEP	19811285
GO:0072091	Process	Regulation of stem cell proliferation	IEA
GO:0072091	Process	Regulation of stem cell proliferation	ISS
GO:0097100	Function	Supercoiled DNA binding	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:1903706	Process	Regulation of hemopoiesis	IEA

Other IDs

• MIM: 163906
• HGNC: 5000
• e!Ensembl: ENSG00000164104

Protein

• UniProt ID: P26583
• Protein name: High mobility group protein B2 (High mobility group protein 2) (HMG-2)
• Protein function: Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription, chromatin remodeling and V(D)J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09011	HMG_box_2	6 → 79	HMG-box domain	Domain
  PF00505	HMG_box	95 → 163	HMG (high mobility group) box	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in gastric and intestinal tissues (at protein level). {ECO:0000269|PubMed:23877675}.
• Sequence:

  MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKF
  EDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGL
  SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTG
  SKKKNEPEDEEEEEEEEDEDEEEEDEDEE

• Sequence length: 209

Pathways

Reactome:

Apoptosis induced DNA fragmentation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	24366584, 27602772		★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	36958298	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	24905701	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	38256095	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25284587, 29050221, 29463261		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22655796	Inhibit	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	36958298	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35403252	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37903974, 39247201, 39591457	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24684392		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25060178, 35403252	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24078503, 33076532, 35812454	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	35726535	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31209930		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22863087, 31209930		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30575817		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23255232, 36811212	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30487376		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28183701		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28183701		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28183701		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19139395, 24905701, 28916968, 31629102		★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive System Neoplasms	BEFREE	31621076		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	31621076		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	14724156	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19240692		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19240692		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28851665		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30487376		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	36958298	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	8918589	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	35726535	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31557418		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22863087		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	20042637		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19041683, 20851854, 30356986		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	20851854		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22863087		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25284587, 29050221, 29463261		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24684392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28069585		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29877212		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30674244, 31694235		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25996293, 30296520, 31621076		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19240692, 28069585, 29463261, 29721183, 30296520, 30674244		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31209930		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31219186		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28011583		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19240692, 20851854, 22863087, 25327479, 29463261, 30296520, 31694235		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36958298	Stimulate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10076573		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	20882379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	24905701, 38175691	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16036111	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28069585		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28069585, 35403252	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21937738		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29050221		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30674244, 31694235		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29877212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinoblastoma	Retinoblastoma	BEFREE	22655796		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	37713866	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	16604350	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25327479	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25327479		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25996293, 30296520, 31621076		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25996293	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21937738	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24571540	Associate	★☆☆☆☆ Found in Text Mining only