HMGB1 (high mobility group box 1)

Gene

• Entrez ID: 3146
• Gene name: High mobility group box 1
• Gene symbol: HMGB1
• Synonyms (NCBI Gene): HMG-1, HMG1, HMG3, SBP-1
• Chromosome: 13
• Chromosome location: 13q12.3
• Summary: This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular proces

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007157	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	23303785
MIRT016305	hsa-miR-193b-3p	Microarray	20304954
MIRT052166	hsa-let-7b-5p	CLASH	23622248
MIRT051522	hsa-let-7e-5p	CLASH	23622248
MIRT050047	hsa-miR-26b-5p	CLASH	23622248
MIRT049759	hsa-miR-92a-3p	CLASH	23622248
MIRT048569	hsa-miR-100-5p	CLASH	23622248
MIRT048039	hsa-miR-148a-3p	CLASH	23622248
MIRT046564	hsa-let-7g-5p	CLASH	23622248
MIRT043798	hsa-miR-328-3p	CLASH	23622248
MIRT043587	hsa-miR-148b-3p	CLASH	23622248
MIRT041163	hsa-miR-181d-5p	CLASH	23622248
MIRT040864	hsa-miR-18a-3p	CLASH	23622248
MIRT039473	hsa-miR-652-3p	CLASH	23622248
MIRT037020	hsa-miR-877-3p	CLASH	23622248
MIRT052918	hsa-miR-218-5p	GFP reporter assay, qRT-PCR, Western blot	24247270
MIRT052918	hsa-miR-218-5p	GFP reporter assay, qRT-PCR, Western blot	24247270
MIRT678241	hsa-miR-122-3p	HITS-CLIP	23313552
MIRT678239	hsa-miR-1247-3p	HITS-CLIP	23313552
MIRT678238	hsa-miR-4532	HITS-CLIP	23313552
MIRT678237	hsa-miR-4485-5p	HITS-CLIP	23313552
MIRT678236	hsa-miR-1281	HITS-CLIP	23313552
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT511559	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT511558	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT511557	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT511556	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT511555	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT511554	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT511553	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT511552	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT511551	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT511550	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT511549	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT511548	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT511547	hsa-miR-302e	HITS-CLIP	23313552
MIRT511546	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT511545	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT511544	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT511543	hsa-miR-520b	HITS-CLIP	23313552
MIRT511542	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT511541	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT511540	hsa-miR-520e	HITS-CLIP	23313552
MIRT511538	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT511537	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT511536	hsa-miR-520h	HITS-CLIP	23313552
MIRT511535	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT687945	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT557269	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT687944	hsa-miR-1913	HITS-CLIP	23313552
MIRT687943	hsa-miR-324-3p	HITS-CLIP	23313552
MIRT040864	hsa-miR-18a-3p	HITS-CLIP	23313552
MIRT511534	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT511532	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT687942	hsa-miR-6790-3p	HITS-CLIP	23313552
MIRT687941	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT687940	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT511531	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT511530	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT687939	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT687938	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT687937	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT511528	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT678241	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT678240	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678239	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT678238	hsa-miR-4532	HITS-CLIP	23824327
MIRT678237	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678236	hsa-miR-1281	HITS-CLIP	23824327
MIRT678234	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678235	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678233	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678232	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678231	hsa-miR-4284	HITS-CLIP	23824327
MIRT678241	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT678240	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678239	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT678238	hsa-miR-4532	HITS-CLIP	23824327
MIRT678237	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678236	hsa-miR-1281	HITS-CLIP	23824327
MIRT678234	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678235	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678233	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678232	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678231	hsa-miR-4284	HITS-CLIP	23824327
MIRT678241	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT678240	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678239	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT678238	hsa-miR-4532	HITS-CLIP	23824327
MIRT678237	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678236	hsa-miR-1281	HITS-CLIP	23824327
MIRT678234	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678235	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678233	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678232	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678231	hsa-miR-4284	HITS-CLIP	23824327
MIRT628130	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT657372	hsa-miR-4275	HITS-CLIP	23824327
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT628128	hsa-miR-891b	HITS-CLIP	23824327
MIRT657371	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT628127	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT628126	hsa-miR-507	HITS-CLIP	23824327
MIRT628125	hsa-miR-557	HITS-CLIP	23824327
MIRT628124	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT616284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT657370	hsa-miR-4324	HITS-CLIP	23824327
MIRT657369	hsa-miR-544b	HITS-CLIP	23824327
MIRT657368	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT657367	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT657366	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT657365	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT657364	hsa-miR-1976	HITS-CLIP	23824327
MIRT657362	hsa-miR-4682	HITS-CLIP	23824327
MIRT657363	hsa-miR-4424	HITS-CLIP	23824327
MIRT657361	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT657360	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT657359	hsa-miR-1200	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT037020	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612895	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT616288	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT616287	hsa-miR-6072	HITS-CLIP	23824327
MIRT616286	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT628130	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT628128	hsa-miR-891b	HITS-CLIP	23824327
MIRT628127	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT628126	hsa-miR-507	HITS-CLIP	23824327
MIRT628125	hsa-miR-557	HITS-CLIP	23824327
MIRT628124	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT616288	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT616972	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616971	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616287	hsa-miR-6072	HITS-CLIP	23824327
MIRT616286	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT616285	hsa-miR-5193	HITS-CLIP	23824327
MIRT616284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT037020	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT616283	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT616970	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT616282	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT616281	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT616280	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT616279	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT616278	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612895	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT616288	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT616287	hsa-miR-6072	HITS-CLIP	23824327
MIRT616286	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT616285	hsa-miR-5193	HITS-CLIP	23824327
MIRT616284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT616283	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT616282	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT616281	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT616280	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT616279	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT616278	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT037020	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612895	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT037020	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612895	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT572008	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT572007	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT572006	hsa-miR-1183	PAR-CLIP	20371350
MIRT572005	hsa-miR-3677-5p	PAR-CLIP	20371350
MIRT572004	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT572003	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT572002	hsa-miR-4673	PAR-CLIP	20371350
MIRT572001	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT572000	hsa-miR-4727-3p	PAR-CLIP	20371350
MIRT571999	hsa-miR-4460	PAR-CLIP	20371350
MIRT567335	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT567334	hsa-miR-548u	PAR-CLIP	20371350
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT567332	hsa-miR-648	PAR-CLIP	20371350
MIRT567331	hsa-miR-4744	PAR-CLIP	20371350
MIRT567330	hsa-miR-4509	PAR-CLIP	20371350
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	20371350
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	20371350
MIRT567327	hsa-miR-3152-3p	PAR-CLIP	20371350
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	20371350
MIRT562243	hsa-miR-8084	PAR-CLIP	20371350
MIRT562242	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT562241	hsa-miR-1179	PAR-CLIP	20371350
MIRT562240	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT511559	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT511558	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT511557	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT511556	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT511555	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT511554	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT511553	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT511552	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT511551	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT511550	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT511549	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT511548	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT511547	hsa-miR-302e	PAR-CLIP	21572407
MIRT511546	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT511545	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT511544	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT511543	hsa-miR-520b	PAR-CLIP	21572407
MIRT511542	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT511541	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT511540	hsa-miR-520e	PAR-CLIP	21572407
MIRT511539	hsa-miR-595	PAR-CLIP	21572407
MIRT511538	hsa-miR-512-3p	PAR-CLIP	21572407
MIRT511537	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT511536	hsa-miR-520h	PAR-CLIP	21572407
MIRT511535	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT557269	hsa-miR-150-5p	PAR-CLIP	21572407
MIRT511534	hsa-miR-619-5p	PAR-CLIP	21572407
MIRT511532	hsa-miR-6506-5p	PAR-CLIP	21572407
MIRT511533	hsa-miR-4252	PAR-CLIP	21572407
MIRT557268	hsa-miR-6778-3p	PAR-CLIP	21572407
MIRT511531	hsa-miR-4731-5p	PAR-CLIP	21572407
MIRT511530	hsa-miR-5589-5p	PAR-CLIP	21572407
MIRT511529	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT511528	hsa-miR-5089-5p	PAR-CLIP	21572407
MIRT511559	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT511558	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT511557	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT511556	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT511555	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT511554	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT511553	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT511552	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT511551	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT511550	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT511549	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT511548	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT511547	hsa-miR-302e	PAR-CLIP	23446348
MIRT511546	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT511545	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT511544	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT511543	hsa-miR-520b	PAR-CLIP	23446348
MIRT511542	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT511541	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT511540	hsa-miR-520e	PAR-CLIP	23446348
MIRT511539	hsa-miR-595	PAR-CLIP	23446348
MIRT511538	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT511534	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT511532	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT511533	hsa-miR-4252	PAR-CLIP	23446348
MIRT511531	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT511530	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT511529	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT511528	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT511559	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT511558	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT511557	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT511556	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT511555	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT511554	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT511553	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT511552	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT511551	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT511550	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT511549	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT511548	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT511547	hsa-miR-302e	PAR-CLIP	23446348
MIRT511546	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT511545	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT511544	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT511543	hsa-miR-520b	PAR-CLIP	23446348
MIRT511542	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT511541	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT511540	hsa-miR-520e	PAR-CLIP	23446348
MIRT511539	hsa-miR-595	PAR-CLIP	23446348
MIRT511538	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT511537	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT511536	hsa-miR-520h	PAR-CLIP	23446348
MIRT511535	hsa-miR-186-3p	PAR-CLIP	23446348
MIRT511534	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT511532	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT511533	hsa-miR-4252	PAR-CLIP	23446348
MIRT511531	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT511530	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT511529	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT511528	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT475616	hsa-miR-219a-1-3p	PAR-CLIP	23592263
MIRT475615	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT475614	hsa-miR-3174	PAR-CLIP	23592263
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT475612	hsa-miR-302b-5p	PAR-CLIP	23592263
MIRT475611	hsa-miR-302d-5p	PAR-CLIP	23592263
MIRT475610	hsa-miR-571	PAR-CLIP	23592263
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	23592263
MIRT340213	hsa-miR-153-3p	2-D Gel Electrophoresis (2DGE), qRT-PCR, Western blot	26633009
MIRT731753	hsa-miR-205-5p	ChIP-seq, Luciferase reporter assay, Next Generation Sequencing (NGS), pSILAC, qRT-PCR, Western blot	26183718
MIRT731753	hsa-miR-205-5p	ChIP-seq, Luciferase reporter assay, Next Generation Sequencing (NGS), pSILAC, qRT-PCR, Western blot	26183718
MIRT567335	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617792
MIRT567335	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617792
MIRT628130	hsa-miR-129-5p	Luciferase reporter assay, qRT-PCR, Western blot	26720492
MIRT628130	hsa-miR-129-5p	Luciferase reporter assay, qRT-PCR, Western blot	26720492
MIRT628130	hsa-miR-129-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27191994
MIRT628130	hsa-miR-129-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27191994
MIRT628130	hsa-miR-129-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27191994
MIRT628130	hsa-miR-129-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27191994
MIRT567335	hsa-miR-142-3p	ELISA, qRT-PCR, Western blot	26721185
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT567330	hsa-miR-4509	PAR-CLIP	26701625
MIRT567330	hsa-miR-4509	PAR-CLIP	26701625
MIRT567330	hsa-miR-4509	PAR-CLIP	26701625
MIRT567330	hsa-miR-4509	PAR-CLIP	26701625
MIRT567330	hsa-miR-4509	PAR-CLIP	26701625
MIRT567330	hsa-miR-4509	PAR-CLIP	26701625
MIRT567330	hsa-miR-4509	PAR-CLIP	26701625
MIRT567331	hsa-miR-4744	PAR-CLIP	26701625
MIRT567331	hsa-miR-4744	PAR-CLIP	26701625
MIRT567331	hsa-miR-4744	PAR-CLIP	26701625
MIRT567331	hsa-miR-4744	PAR-CLIP	26701625
MIRT567331	hsa-miR-4744	PAR-CLIP	26701625
MIRT567331	hsa-miR-4744	PAR-CLIP	26701625
MIRT567331	hsa-miR-4744	PAR-CLIP	26701625
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT567334	hsa-miR-548u	PAR-CLIP	26701625
MIRT567334	hsa-miR-548u	PAR-CLIP	26701625
MIRT567334	hsa-miR-548u	PAR-CLIP	26701625
MIRT567334	hsa-miR-548u	PAR-CLIP	26701625
MIRT567334	hsa-miR-548u	PAR-CLIP	26701625
MIRT567334	hsa-miR-548u	PAR-CLIP	26701625
MIRT567334	hsa-miR-548u	PAR-CLIP	26701625
MIRT567334	hsa-miR-548u	PAR-CLIP	26701625
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	26701625
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	26701625
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	26701625
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	26701625
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	26701625
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	26701625
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	26701625
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	26701625
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	26701625
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	26701625
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	26701625
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	26701625
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	26701625
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	26701625
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	26701625
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	26701625
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	26701625
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	26701625
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	26701625
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	26701625
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	26701625
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	26701625
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	26701625
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	26701625
MIRT732673	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33527767
MIRT732673	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33527767
MIRT511554	hsa-miR-519d-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	32602212
MIRT733855	hsa-miR-574-5p	Luciferase reporter assay, qRT-PCR	33202146
MIRT734297	hsa-miR-548b-3p	Luciferase reporter assay, qRT-PCR, Western blotting	31417317
MIRT734841	hsa-miR-34c-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32157741
MIRT735723	hsa-miR-300	Luciferase reporter assay, Western blotting	31872385
MIRT734297	hsa-miR-548b-3p	Luciferase reporter assay, qRT-PCR	33750228
MIRT734297	hsa-miR-548b-3p	Luciferase reporter assay, qRT-PCR	33750228
MIRT736336	hsa-miR-188-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR, Flow cytometry	33176595
MIRT562241	hsa-miR-1179	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), RNA-seq, qRT-PCR	31951855
MIRT678241	hsa-miR-122-3p	HITS-CLIP	23313552
MIRT678239	hsa-miR-1247-3p	HITS-CLIP	23313552
MIRT678238	hsa-miR-4532	HITS-CLIP	23313552
MIRT678237	hsa-miR-4485-5p	HITS-CLIP	23313552
MIRT678236	hsa-miR-1281	HITS-CLIP	23313552
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT511559	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT511558	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT511557	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT511556	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT511555	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT511554	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT511553	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT511552	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT511551	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT511550	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT511549	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT511548	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT511547	hsa-miR-302e	HITS-CLIP	23313552
MIRT511546	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT511545	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT511544	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT511543	hsa-miR-520b	HITS-CLIP	23313552
MIRT511542	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT511541	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT511540	hsa-miR-520e	HITS-CLIP	23313552
MIRT511538	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT511537	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT511536	hsa-miR-520h	HITS-CLIP	23313552
MIRT511535	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT687945	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT557269	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT687944	hsa-miR-1913	HITS-CLIP	23313552
MIRT687943	hsa-miR-324-3p	HITS-CLIP	23313552
MIRT040864	hsa-miR-18a-3p	HITS-CLIP	23313552
MIRT511534	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT511532	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT687942	hsa-miR-6790-3p	HITS-CLIP	23313552
MIRT687941	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT687940	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT511531	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT511530	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT687939	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT687938	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT687937	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT511528	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT678241	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT678240	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678239	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT678238	hsa-miR-4532	HITS-CLIP	23824327
MIRT678237	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678236	hsa-miR-1281	HITS-CLIP	23824327
MIRT678234	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678235	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678233	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678232	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678231	hsa-miR-4284	HITS-CLIP	23824327
MIRT678241	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT678240	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678239	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT678238	hsa-miR-4532	HITS-CLIP	23824327
MIRT678237	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678236	hsa-miR-1281	HITS-CLIP	23824327
MIRT678234	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678235	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678233	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678232	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678231	hsa-miR-4284	HITS-CLIP	23824327
MIRT678241	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT678240	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678239	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT678238	hsa-miR-4532	HITS-CLIP	23824327
MIRT678237	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678236	hsa-miR-1281	HITS-CLIP	23824327
MIRT678234	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678235	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678233	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678232	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT557268	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678231	hsa-miR-4284	HITS-CLIP	23824327
MIRT628130	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT657372	hsa-miR-4275	HITS-CLIP	23824327
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT628128	hsa-miR-891b	HITS-CLIP	23824327
MIRT657371	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT628127	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT628126	hsa-miR-507	HITS-CLIP	23824327
MIRT628125	hsa-miR-557	HITS-CLIP	23824327
MIRT628124	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT616284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT657370	hsa-miR-4324	HITS-CLIP	23824327
MIRT657369	hsa-miR-544b	HITS-CLIP	23824327
MIRT657368	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT657367	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT657366	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT657365	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT657364	hsa-miR-1976	HITS-CLIP	23824327
MIRT657362	hsa-miR-4682	HITS-CLIP	23824327
MIRT657363	hsa-miR-4424	HITS-CLIP	23824327
MIRT657361	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT657360	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT657359	hsa-miR-1200	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT037020	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612895	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT616288	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT616287	hsa-miR-6072	HITS-CLIP	23824327
MIRT616286	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT628130	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT628129	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT628128	hsa-miR-891b	HITS-CLIP	23824327
MIRT628127	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT628126	hsa-miR-507	HITS-CLIP	23824327
MIRT628125	hsa-miR-557	HITS-CLIP	23824327
MIRT628124	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT616288	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT616972	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT616971	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT616287	hsa-miR-6072	HITS-CLIP	23824327
MIRT616286	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT616285	hsa-miR-5193	HITS-CLIP	23824327
MIRT616284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT037020	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT616283	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT616970	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT616282	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT616281	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT616280	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT616279	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT616278	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612895	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT616288	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT616287	hsa-miR-6072	HITS-CLIP	23824327
MIRT616286	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT616285	hsa-miR-5193	HITS-CLIP	23824327
MIRT616284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT616283	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT616282	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT616281	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT616280	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT616279	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT616278	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT037020	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612895	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT612899	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT037020	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT612898	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT612897	hsa-miR-1248	HITS-CLIP	23824327
MIRT612896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612895	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT612894	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT572008	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT572007	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT572006	hsa-miR-1183	PAR-CLIP	20371350
MIRT572005	hsa-miR-3677-5p	PAR-CLIP	20371350
MIRT572004	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT572003	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT572002	hsa-miR-4673	PAR-CLIP	20371350
MIRT572001	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT572000	hsa-miR-4727-3p	PAR-CLIP	20371350
MIRT571999	hsa-miR-4460	PAR-CLIP	20371350
MIRT567335	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT567334	hsa-miR-548u	PAR-CLIP	20371350
MIRT567333	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT567332	hsa-miR-648	PAR-CLIP	20371350
MIRT567331	hsa-miR-4744	PAR-CLIP	20371350
MIRT567330	hsa-miR-4509	PAR-CLIP	20371350
MIRT567329	hsa-miR-642a-3p	PAR-CLIP	20371350
MIRT567328	hsa-miR-642b-3p	PAR-CLIP	20371350
MIRT567327	hsa-miR-3152-3p	PAR-CLIP	20371350
MIRT567326	hsa-miR-4798-5p	PAR-CLIP	20371350
MIRT562243	hsa-miR-8084	PAR-CLIP	20371350
MIRT562242	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT562241	hsa-miR-1179	PAR-CLIP	20371350
MIRT562240	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT511559	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT511558	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT511557	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT511556	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT511555	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT511554	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT511553	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT511552	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT511551	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT511550	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT511549	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT511548	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT511547	hsa-miR-302e	PAR-CLIP	21572407
MIRT511546	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT511545	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT511544	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT511543	hsa-miR-520b	PAR-CLIP	21572407
MIRT511542	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT511541	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT511540	hsa-miR-520e	PAR-CLIP	21572407
MIRT511539	hsa-miR-595	PAR-CLIP	21572407
MIRT511538	hsa-miR-512-3p	PAR-CLIP	21572407
MIRT511537	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT511536	hsa-miR-520h	PAR-CLIP	21572407
MIRT511535	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT557269	hsa-miR-150-5p	PAR-CLIP	21572407
MIRT511534	hsa-miR-619-5p	PAR-CLIP	21572407
MIRT511532	hsa-miR-6506-5p	PAR-CLIP	21572407
MIRT511533	hsa-miR-4252	PAR-CLIP	21572407
MIRT557268	hsa-miR-6778-3p	PAR-CLIP	21572407
MIRT511531	hsa-miR-4731-5p	PAR-CLIP	21572407
MIRT511530	hsa-miR-5589-5p	PAR-CLIP	21572407
MIRT511529	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT511528	hsa-miR-5089-5p	PAR-CLIP	21572407
MIRT511559	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT511558	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT511557	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT511556	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT511555	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT511554	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT511553	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT511552	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT511551	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT511550	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT511549	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT511548	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT511547	hsa-miR-302e	PAR-CLIP	23446348
MIRT511546	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT511545	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT511544	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT511543	hsa-miR-520b	PAR-CLIP	23446348
MIRT511542	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT511541	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT511540	hsa-miR-520e	PAR-CLIP	23446348
MIRT511539	hsa-miR-595	PAR-CLIP	23446348
MIRT511538	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT511534	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT511532	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT511533	hsa-miR-4252	PAR-CLIP	23446348
MIRT511531	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT511530	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT511529	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT511528	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT511559	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT511558	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT511557	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT511556	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT511555	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT511554	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT511553	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT511552	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT511551	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT511550	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT511549	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT511548	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT511547	hsa-miR-302e	PAR-CLIP	23446348
MIRT511546	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT511545	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT511544	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT511543	hsa-miR-520b	PAR-CLIP	23446348
MIRT511542	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT511541	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT511540	hsa-miR-520e	PAR-CLIP	23446348
MIRT511539	hsa-miR-595	PAR-CLIP	23446348
MIRT511538	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT511537	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT511536	hsa-miR-520h	PAR-CLIP	23446348
MIRT511535	hsa-miR-186-3p	PAR-CLIP	23446348
MIRT511534	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT511532	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT511533	hsa-miR-4252	PAR-CLIP	23446348
MIRT511531	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT511530	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT511529	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT511528	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT475616	hsa-miR-219a-1-3p	PAR-CLIP	23592263
MIRT475615	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT475614	hsa-miR-3174	PAR-CLIP	23592263
MIRT475613	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT475612	hsa-miR-302b-5p	PAR-CLIP	23592263
MIRT475611	hsa-miR-302d-5p	PAR-CLIP	23592263
MIRT475610	hsa-miR-571	PAR-CLIP	23592263
MIRT475609	hsa-miR-3177-5p	PAR-CLIP	23592263
MIRT1049152	hsa-miR-101	CLIP-seq
MIRT1049153	hsa-miR-1197	CLIP-seq
MIRT1049154	hsa-miR-1266	CLIP-seq
MIRT1049155	hsa-miR-1273f	CLIP-seq
MIRT1049156	hsa-miR-1284	CLIP-seq
MIRT1049157	hsa-miR-1290	CLIP-seq
MIRT1049158	hsa-miR-142-5p	CLIP-seq
MIRT1049159	hsa-miR-143	CLIP-seq
MIRT1049160	hsa-miR-144	CLIP-seq
MIRT1049161	hsa-miR-1537	CLIP-seq
MIRT1049162	hsa-miR-181a	CLIP-seq
MIRT1049163	hsa-miR-181b	CLIP-seq
MIRT1049164	hsa-miR-181c	CLIP-seq
MIRT1049165	hsa-miR-181d	CLIP-seq
MIRT1049166	hsa-miR-190	CLIP-seq
MIRT1049167	hsa-miR-1909	CLIP-seq
MIRT1049168	hsa-miR-190b	CLIP-seq
MIRT1049169	hsa-miR-205	CLIP-seq
MIRT1049170	hsa-miR-2110	CLIP-seq
MIRT1049171	hsa-miR-2113	CLIP-seq
MIRT1049172	hsa-miR-218	CLIP-seq
MIRT1049173	hsa-miR-219-1-3p	CLIP-seq
MIRT1049174	hsa-miR-3065-5p	CLIP-seq
MIRT1049175	hsa-miR-3129-3p	CLIP-seq
MIRT1049176	hsa-miR-3140-3p	CLIP-seq
MIRT1049177	hsa-miR-3150a-3p	CLIP-seq
MIRT1049178	hsa-miR-3167	CLIP-seq
MIRT1049179	hsa-miR-320e	CLIP-seq
MIRT1049180	hsa-miR-337-3p	CLIP-seq
MIRT1049181	hsa-miR-340	CLIP-seq
MIRT1049182	hsa-miR-3613-3p	CLIP-seq
MIRT1049183	hsa-miR-3647-3p	CLIP-seq
MIRT1049184	hsa-miR-3650	CLIP-seq
MIRT1049185	hsa-miR-3664-3p	CLIP-seq
MIRT1049186	hsa-miR-381	CLIP-seq
MIRT1049187	hsa-miR-3919	CLIP-seq
MIRT1049188	hsa-miR-3941	CLIP-seq
MIRT1049189	hsa-miR-410	CLIP-seq
MIRT1049190	hsa-miR-4260	CLIP-seq
MIRT1049191	hsa-miR-4262	CLIP-seq
MIRT1049192	hsa-miR-4282	CLIP-seq
MIRT1049193	hsa-miR-4318	CLIP-seq
MIRT1049194	hsa-miR-4450	CLIP-seq
MIRT1049195	hsa-miR-4455	CLIP-seq
MIRT1049196	hsa-miR-4470	CLIP-seq
MIRT1049197	hsa-miR-4518	CLIP-seq
MIRT1049198	hsa-miR-4536	CLIP-seq
MIRT1049199	hsa-miR-4640-3p	CLIP-seq
MIRT1049200	hsa-miR-4659a-3p	CLIP-seq
MIRT1049201	hsa-miR-4659b-3p	CLIP-seq
MIRT1049202	hsa-miR-466	CLIP-seq
MIRT1049203	hsa-miR-4661-5p	CLIP-seq
MIRT1049204	hsa-miR-4666-3p	CLIP-seq
MIRT1049205	hsa-miR-4672	CLIP-seq
MIRT1049206	hsa-miR-4688	CLIP-seq
MIRT1049207	hsa-miR-4698	CLIP-seq
MIRT1049208	hsa-miR-4699-5p	CLIP-seq
MIRT1049209	hsa-miR-4700-3p	CLIP-seq
MIRT1049210	hsa-miR-4708-5p	CLIP-seq
MIRT1049211	hsa-miR-4711-5p	CLIP-seq
MIRT1049212	hsa-miR-4719	CLIP-seq
MIRT1049213	hsa-miR-4735-5p	CLIP-seq
MIRT1049214	hsa-miR-4756-3p	CLIP-seq
MIRT1049215	hsa-miR-4762-5p	CLIP-seq
MIRT1049216	hsa-miR-4770	CLIP-seq
MIRT1049217	hsa-miR-4797-5p	CLIP-seq
MIRT1049218	hsa-miR-4799-5p	CLIP-seq
MIRT1049219	hsa-miR-495	CLIP-seq
MIRT1049220	hsa-miR-499a-5p	CLIP-seq
MIRT1049221	hsa-miR-505	CLIP-seq
MIRT1049222	hsa-miR-511	CLIP-seq
MIRT1049223	hsa-miR-513a-3p	CLIP-seq
MIRT1049224	hsa-miR-514	CLIP-seq
MIRT1049225	hsa-miR-514b-3p	CLIP-seq
MIRT1049226	hsa-miR-518a-5p	CLIP-seq
MIRT1049227	hsa-miR-527	CLIP-seq
MIRT1049228	hsa-miR-548ac	CLIP-seq
MIRT1049229	hsa-miR-548ae	CLIP-seq
MIRT1049230	hsa-miR-548aj	CLIP-seq
MIRT1049231	hsa-miR-548am	CLIP-seq
MIRT1049232	hsa-miR-548d-3p	CLIP-seq
MIRT1049233	hsa-miR-548p	CLIP-seq
MIRT1049234	hsa-miR-548x	CLIP-seq
MIRT1049235	hsa-miR-548z	CLIP-seq
MIRT1049236	hsa-miR-549	CLIP-seq
MIRT1049237	hsa-miR-561	CLIP-seq
MIRT1049238	hsa-miR-576-5p	CLIP-seq
MIRT1049239	hsa-miR-577	CLIP-seq
MIRT1049240	hsa-miR-582-5p	CLIP-seq
MIRT1049241	hsa-miR-587	CLIP-seq
MIRT1049242	hsa-miR-600	CLIP-seq
MIRT1049243	hsa-miR-607	CLIP-seq
MIRT1049244	hsa-miR-642b	CLIP-seq
MIRT1049245	hsa-miR-759	CLIP-seq
MIRT1049246	hsa-miR-767-5p	CLIP-seq
MIRT1049247	hsa-miR-876-5p	CLIP-seq
MIRT1049248	hsa-miR-890	CLIP-seq
MIRT1049249	hsa-miR-935	CLIP-seq
MIRT1049250	hsa-miR-936	CLIP-seq
MIRT1049251	hsa-miR-944	CLIP-seq
MIRT1049179	hsa-miR-320e	CLIP-seq
MIRT1049187	hsa-miR-3919	CLIP-seq
MIRT1049211	hsa-miR-4711-5p	CLIP-seq
MIRT1049214	hsa-miR-4756-3p	CLIP-seq
MIRT1049236	hsa-miR-549	CLIP-seq
MIRT2011267	hsa-miR-1245b-3p	CLIP-seq
MIRT2011268	hsa-miR-1246	CLIP-seq
MIRT2011269	hsa-miR-1255a	CLIP-seq
MIRT2011270	hsa-miR-1255b	CLIP-seq
MIRT1049155	hsa-miR-1273f	CLIP-seq
MIRT1049156	hsa-miR-1284	CLIP-seq
MIRT1049157	hsa-miR-1290	CLIP-seq
MIRT1049158	hsa-miR-142-5p	CLIP-seq
MIRT1049159	hsa-miR-143	CLIP-seq
MIRT1049166	hsa-miR-190	CLIP-seq
MIRT1049167	hsa-miR-1909	CLIP-seq
MIRT1049168	hsa-miR-190b	CLIP-seq
MIRT1049169	hsa-miR-205	CLIP-seq
MIRT2011271	hsa-miR-2052	CLIP-seq
MIRT1049171	hsa-miR-2113	CLIP-seq
MIRT2011272	hsa-miR-216a	CLIP-seq
MIRT2011273	hsa-miR-216b	CLIP-seq
MIRT1049172	hsa-miR-218	CLIP-seq
MIRT1049173	hsa-miR-219-1-3p	CLIP-seq
MIRT2011274	hsa-miR-2276	CLIP-seq
MIRT1049174	hsa-miR-3065-5p	CLIP-seq
MIRT2011275	hsa-miR-3074-5p	CLIP-seq
MIRT1049175	hsa-miR-3129-3p	CLIP-seq
MIRT1049178	hsa-miR-3167	CLIP-seq
MIRT1049179	hsa-miR-320e	CLIP-seq
MIRT1049180	hsa-miR-337-3p	CLIP-seq
MIRT1049181	hsa-miR-340	CLIP-seq
MIRT1049182	hsa-miR-3613-3p	CLIP-seq
MIRT1049184	hsa-miR-3650	CLIP-seq
MIRT2011276	hsa-miR-3653	CLIP-seq
MIRT2011277	hsa-miR-3658	CLIP-seq
MIRT1049187	hsa-miR-3919	CLIP-seq
MIRT1049188	hsa-miR-3941	CLIP-seq
MIRT1049189	hsa-miR-410	CLIP-seq
MIRT2011278	hsa-miR-412	CLIP-seq
MIRT2011279	hsa-miR-4274	CLIP-seq
MIRT1049192	hsa-miR-4282	CLIP-seq
MIRT2011280	hsa-miR-4330	CLIP-seq
MIRT2011281	hsa-miR-4420	CLIP-seq
MIRT1049195	hsa-miR-4455	CLIP-seq
MIRT2011282	hsa-miR-4468	CLIP-seq
MIRT2011283	hsa-miR-452	CLIP-seq
MIRT2011284	hsa-miR-4540	CLIP-seq
MIRT2011285	hsa-miR-455-3p	CLIP-seq
MIRT1049199	hsa-miR-4640-3p	CLIP-seq
MIRT1049200	hsa-miR-4659a-3p	CLIP-seq
MIRT1049201	hsa-miR-4659b-3p	CLIP-seq
MIRT1049202	hsa-miR-466	CLIP-seq
MIRT1049205	hsa-miR-4672	CLIP-seq
MIRT2011286	hsa-miR-4676-3p	CLIP-seq
MIRT1049207	hsa-miR-4698	CLIP-seq
MIRT1049208	hsa-miR-4699-5p	CLIP-seq
MIRT1049210	hsa-miR-4708-5p	CLIP-seq
MIRT1049211	hsa-miR-4711-5p	CLIP-seq
MIRT1049213	hsa-miR-4735-5p	CLIP-seq
MIRT1049214	hsa-miR-4756-3p	CLIP-seq
MIRT2011287	hsa-miR-4760-5p	CLIP-seq
MIRT1049215	hsa-miR-4762-5p	CLIP-seq
MIRT2011288	hsa-miR-4764-5p	CLIP-seq
MIRT1049216	hsa-miR-4770	CLIP-seq
MIRT2011289	hsa-miR-4773	CLIP-seq
MIRT1049217	hsa-miR-4797-5p	CLIP-seq
MIRT1049220	hsa-miR-499a-5p	CLIP-seq
MIRT1049221	hsa-miR-505	CLIP-seq
MIRT1049222	hsa-miR-511	CLIP-seq
MIRT1049223	hsa-miR-513a-3p	CLIP-seq
MIRT1049226	hsa-miR-518a-5p	CLIP-seq
MIRT1049227	hsa-miR-527	CLIP-seq
MIRT2011290	hsa-miR-548aa	CLIP-seq
MIRT1049228	hsa-miR-548ac	CLIP-seq
MIRT2011291	hsa-miR-548ad	CLIP-seq
MIRT1049229	hsa-miR-548ae	CLIP-seq
MIRT1049230	hsa-miR-548aj	CLIP-seq
MIRT1049231	hsa-miR-548am	CLIP-seq
MIRT1049232	hsa-miR-548d-3p	CLIP-seq
MIRT1049234	hsa-miR-548x	CLIP-seq
MIRT1049235	hsa-miR-548z	CLIP-seq
MIRT1049236	hsa-miR-549	CLIP-seq
MIRT1049237	hsa-miR-561	CLIP-seq
MIRT2011292	hsa-miR-570	CLIP-seq
MIRT1049238	hsa-miR-576-5p	CLIP-seq
MIRT1049239	hsa-miR-577	CLIP-seq
MIRT1049240	hsa-miR-582-5p	CLIP-seq
MIRT1049241	hsa-miR-587	CLIP-seq
MIRT1049242	hsa-miR-600	CLIP-seq
MIRT1049243	hsa-miR-607	CLIP-seq
MIRT2011293	hsa-miR-665	CLIP-seq
MIRT1049245	hsa-miR-759	CLIP-seq
MIRT1049246	hsa-miR-767-5p	CLIP-seq
MIRT1049247	hsa-miR-876-5p	CLIP-seq
MIRT1049248	hsa-miR-890	CLIP-seq
MIRT1049249	hsa-miR-935	CLIP-seq
MIRT1049251	hsa-miR-944	CLIP-seq
MIRT1049152	hsa-miR-101	CLIP-seq
MIRT2011267	hsa-miR-1245b-3p	CLIP-seq
MIRT2011268	hsa-miR-1246	CLIP-seq
MIRT1049156	hsa-miR-1284	CLIP-seq
MIRT2243480	hsa-miR-141	CLIP-seq
MIRT1049160	hsa-miR-144	CLIP-seq
MIRT2243481	hsa-miR-186	CLIP-seq
MIRT2243482	hsa-miR-200a	CLIP-seq
MIRT1049169	hsa-miR-205	CLIP-seq
MIRT2243483	hsa-miR-2054	CLIP-seq
MIRT1049171	hsa-miR-2113	CLIP-seq
MIRT2011272	hsa-miR-216a	CLIP-seq
MIRT2011273	hsa-miR-216b	CLIP-seq
MIRT1049172	hsa-miR-218	CLIP-seq
MIRT1049173	hsa-miR-219-1-3p	CLIP-seq
MIRT1049174	hsa-miR-3065-5p	CLIP-seq
MIRT2011275	hsa-miR-3074-5p	CLIP-seq
MIRT1049175	hsa-miR-3129-3p	CLIP-seq
MIRT1049179	hsa-miR-320e	CLIP-seq
MIRT1049182	hsa-miR-3613-3p	CLIP-seq
MIRT1049183	hsa-miR-3647-3p	CLIP-seq
MIRT2011276	hsa-miR-3653	CLIP-seq
MIRT2011277	hsa-miR-3658	CLIP-seq
MIRT2243484	hsa-miR-3688-3p	CLIP-seq
MIRT1049186	hsa-miR-381	CLIP-seq
MIRT1049187	hsa-miR-3919	CLIP-seq
MIRT1049188	hsa-miR-3941	CLIP-seq
MIRT2243485	hsa-miR-3978	CLIP-seq
MIRT1049189	hsa-miR-410	CLIP-seq
MIRT2011279	hsa-miR-4274	CLIP-seq
MIRT2011280	hsa-miR-4330	CLIP-seq
MIRT2011282	hsa-miR-4468	CLIP-seq
MIRT2011283	hsa-miR-452	CLIP-seq
MIRT2011284	hsa-miR-4540	CLIP-seq
MIRT2011285	hsa-miR-455-3p	CLIP-seq
MIRT1049202	hsa-miR-466	CLIP-seq
MIRT1049204	hsa-miR-4666-3p	CLIP-seq
MIRT1049205	hsa-miR-4672	CLIP-seq
MIRT2011286	hsa-miR-4676-3p	CLIP-seq
MIRT1049208	hsa-miR-4699-5p	CLIP-seq
MIRT1049211	hsa-miR-4711-5p	CLIP-seq
MIRT1049213	hsa-miR-4735-5p	CLIP-seq
MIRT1049214	hsa-miR-4756-3p	CLIP-seq
MIRT2011287	hsa-miR-4760-5p	CLIP-seq
MIRT1049215	hsa-miR-4762-5p	CLIP-seq
MIRT2011288	hsa-miR-4764-5p	CLIP-seq
MIRT1049217	hsa-miR-4797-5p	CLIP-seq
MIRT1049218	hsa-miR-4799-5p	CLIP-seq
MIRT2243486	hsa-miR-488	CLIP-seq
MIRT1049220	hsa-miR-499a-5p	CLIP-seq
MIRT1049221	hsa-miR-505	CLIP-seq
MIRT1049223	hsa-miR-513a-3p	CLIP-seq
MIRT2011290	hsa-miR-548aa	CLIP-seq
MIRT1049228	hsa-miR-548ac	CLIP-seq
MIRT2011291	hsa-miR-548ad	CLIP-seq
MIRT1049229	hsa-miR-548ae	CLIP-seq
MIRT1049230	hsa-miR-548aj	CLIP-seq
MIRT1049231	hsa-miR-548am	CLIP-seq
MIRT1049232	hsa-miR-548d-3p	CLIP-seq
MIRT1049234	hsa-miR-548x	CLIP-seq
MIRT1049235	hsa-miR-548z	CLIP-seq
MIRT1049236	hsa-miR-549	CLIP-seq
MIRT1049237	hsa-miR-561	CLIP-seq
MIRT1049239	hsa-miR-577	CLIP-seq
MIRT1049240	hsa-miR-582-5p	CLIP-seq
MIRT1049241	hsa-miR-587	CLIP-seq
MIRT1049242	hsa-miR-600	CLIP-seq
MIRT1049244	hsa-miR-642b	CLIP-seq
MIRT2011293	hsa-miR-665	CLIP-seq
MIRT1049245	hsa-miR-759	CLIP-seq
MIRT1049246	hsa-miR-767-5p	CLIP-seq
MIRT1049249	hsa-miR-935	CLIP-seq
MIRT1049250	hsa-miR-936	CLIP-seq
MIRT1049251	hsa-miR-944	CLIP-seq
MIRT1049183	hsa-miR-3647-3p	CLIP-seq
MIRT1049207	hsa-miR-4698	CLIP-seq
MIRT1049217	hsa-miR-4797-5p	CLIP-seq
MIRT1049245	hsa-miR-759	CLIP-seq
MIRT1049249	hsa-miR-935	CLIP-seq
MIRT1049174	hsa-miR-3065-5p	CLIP-seq
MIRT1049221	hsa-miR-505	CLIP-seq
MIRT1049174	hsa-miR-3065-5p	CLIP-seq
MIRT1049221	hsa-miR-505	CLIP-seq
MIRT1049154	hsa-miR-1266	CLIP-seq
MIRT1049155	hsa-miR-1273f	CLIP-seq
MIRT1049157	hsa-miR-1290	CLIP-seq
MIRT2546683	hsa-miR-1292	CLIP-seq
MIRT1049158	hsa-miR-142-5p	CLIP-seq
MIRT1049159	hsa-miR-143	CLIP-seq
MIRT1049161	hsa-miR-1537	CLIP-seq
MIRT1049162	hsa-miR-181a	CLIP-seq
MIRT1049163	hsa-miR-181b	CLIP-seq
MIRT1049164	hsa-miR-181c	CLIP-seq
MIRT1049165	hsa-miR-181d	CLIP-seq
MIRT2546684	hsa-miR-183	CLIP-seq
MIRT2243481	hsa-miR-186	CLIP-seq
MIRT1049169	hsa-miR-205	CLIP-seq
MIRT2011271	hsa-miR-2052	CLIP-seq
MIRT1049170	hsa-miR-2110	CLIP-seq
MIRT1049171	hsa-miR-2113	CLIP-seq
MIRT2011272	hsa-miR-216a	CLIP-seq
MIRT2011273	hsa-miR-216b	CLIP-seq
MIRT1049172	hsa-miR-218	CLIP-seq
MIRT1049173	hsa-miR-219-1-3p	CLIP-seq
MIRT2546685	hsa-miR-299-3p	CLIP-seq
MIRT1049174	hsa-miR-3065-5p	CLIP-seq
MIRT1049175	hsa-miR-3129-3p	CLIP-seq
MIRT2546686	hsa-miR-3133	CLIP-seq
MIRT2546687	hsa-miR-3136-3p	CLIP-seq
MIRT1049176	hsa-miR-3140-3p	CLIP-seq
MIRT1049177	hsa-miR-3150a-3p	CLIP-seq
MIRT1049178	hsa-miR-3167	CLIP-seq
MIRT2546688	hsa-miR-320b	CLIP-seq
MIRT2546689	hsa-miR-320c	CLIP-seq
MIRT2546690	hsa-miR-320d	CLIP-seq
MIRT1049179	hsa-miR-320e	CLIP-seq
MIRT1049180	hsa-miR-337-3p	CLIP-seq
MIRT1049181	hsa-miR-340	CLIP-seq
MIRT2546691	hsa-miR-34a	CLIP-seq
MIRT1049182	hsa-miR-3613-3p	CLIP-seq
MIRT2011276	hsa-miR-3653	CLIP-seq
MIRT2011277	hsa-miR-3658	CLIP-seq
MIRT1049185	hsa-miR-3664-3p	CLIP-seq
MIRT2546692	hsa-miR-3671	CLIP-seq
MIRT2546693	hsa-miR-3672	CLIP-seq
MIRT2546694	hsa-miR-3688-5p	CLIP-seq
MIRT1049188	hsa-miR-3941	CLIP-seq
MIRT1049189	hsa-miR-410	CLIP-seq
MIRT1049190	hsa-miR-4260	CLIP-seq
MIRT1049191	hsa-miR-4262	CLIP-seq
MIRT1049192	hsa-miR-4282	CLIP-seq
MIRT2546695	hsa-miR-4429	CLIP-seq
MIRT1049194	hsa-miR-4450	CLIP-seq
MIRT1049196	hsa-miR-4470	CLIP-seq
MIRT2546696	hsa-miR-4471	CLIP-seq
MIRT2546697	hsa-miR-4495	CLIP-seq
MIRT2546698	hsa-miR-4496	CLIP-seq
MIRT2546699	hsa-miR-449a	CLIP-seq
MIRT2546700	hsa-miR-449b	CLIP-seq
MIRT2546701	hsa-miR-4503	CLIP-seq
MIRT2546702	hsa-miR-4506	CLIP-seq
MIRT2546703	hsa-miR-4517	CLIP-seq
MIRT1049197	hsa-miR-4518	CLIP-seq
MIRT2011284	hsa-miR-4540	CLIP-seq
MIRT2546704	hsa-miR-4633-5p	CLIP-seq
MIRT2546705	hsa-miR-4642	CLIP-seq
MIRT2546706	hsa-miR-4648	CLIP-seq
MIRT2546707	hsa-miR-4653-3p	CLIP-seq
MIRT2546708	hsa-miR-4654	CLIP-seq
MIRT1049200	hsa-miR-4659a-3p	CLIP-seq
MIRT1049201	hsa-miR-4659b-3p	CLIP-seq
MIRT1049202	hsa-miR-466	CLIP-seq
MIRT2546709	hsa-miR-4666-5p	CLIP-seq
MIRT1049205	hsa-miR-4672	CLIP-seq
MIRT1049206	hsa-miR-4688	CLIP-seq
MIRT1049207	hsa-miR-4698	CLIP-seq
MIRT1049208	hsa-miR-4699-5p	CLIP-seq
MIRT1049210	hsa-miR-4708-5p	CLIP-seq
MIRT1049213	hsa-miR-4735-5p	CLIP-seq
MIRT2546710	hsa-miR-4760-3p	CLIP-seq
MIRT2546711	hsa-miR-4769-3p	CLIP-seq
MIRT2546712	hsa-miR-4769-5p	CLIP-seq
MIRT1049216	hsa-miR-4770	CLIP-seq
MIRT2011289	hsa-miR-4773	CLIP-seq
MIRT2546713	hsa-miR-4802-3p	CLIP-seq
MIRT2546714	hsa-miR-485-3p	CLIP-seq
MIRT1049220	hsa-miR-499a-5p	CLIP-seq
MIRT1049221	hsa-miR-505	CLIP-seq
MIRT1049222	hsa-miR-511	CLIP-seq
MIRT1049223	hsa-miR-513a-3p	CLIP-seq
MIRT1049226	hsa-miR-518a-5p	CLIP-seq
MIRT1049227	hsa-miR-527	CLIP-seq
MIRT2546715	hsa-miR-532-5p	CLIP-seq
MIRT2011290	hsa-miR-548aa	CLIP-seq
MIRT2011291	hsa-miR-548ad	CLIP-seq
MIRT1049229	hsa-miR-548ae	CLIP-seq
MIRT1049230	hsa-miR-548aj	CLIP-seq
MIRT1049231	hsa-miR-548am	CLIP-seq
MIRT2546716	hsa-miR-548c-3p	CLIP-seq
MIRT2546717	hsa-miR-548e	CLIP-seq
MIRT2546718	hsa-miR-548f	CLIP-seq
MIRT2546719	hsa-miR-548m	CLIP-seq
MIRT1049234	hsa-miR-548x	CLIP-seq
MIRT1049236	hsa-miR-549	CLIP-seq
MIRT1049237	hsa-miR-561	CLIP-seq
MIRT1049238	hsa-miR-576-5p	CLIP-seq
MIRT1049239	hsa-miR-577	CLIP-seq
MIRT1049241	hsa-miR-587	CLIP-seq
MIRT1049243	hsa-miR-607	CLIP-seq
MIRT2546720	hsa-miR-643	CLIP-seq
MIRT1049246	hsa-miR-767-5p	CLIP-seq
MIRT1049247	hsa-miR-876-5p	CLIP-seq
MIRT2546721	hsa-miR-885-5p	CLIP-seq
MIRT2546722	hsa-miR-889	CLIP-seq
MIRT1049248	hsa-miR-890	CLIP-seq
MIRT1049154	hsa-miR-1266	CLIP-seq
MIRT1049155	hsa-miR-1273f	CLIP-seq
MIRT1049157	hsa-miR-1290	CLIP-seq
MIRT2546683	hsa-miR-1292	CLIP-seq
MIRT1049158	hsa-miR-142-5p	CLIP-seq
MIRT1049159	hsa-miR-143	CLIP-seq
MIRT1049161	hsa-miR-1537	CLIP-seq
MIRT1049162	hsa-miR-181a	CLIP-seq
MIRT1049163	hsa-miR-181b	CLIP-seq
MIRT1049164	hsa-miR-181c	CLIP-seq
MIRT1049165	hsa-miR-181d	CLIP-seq
MIRT2546684	hsa-miR-183	CLIP-seq
MIRT2243481	hsa-miR-186	CLIP-seq
MIRT1049169	hsa-miR-205	CLIP-seq
MIRT2011271	hsa-miR-2052	CLIP-seq
MIRT1049170	hsa-miR-2110	CLIP-seq
MIRT1049171	hsa-miR-2113	CLIP-seq
MIRT2011272	hsa-miR-216a	CLIP-seq
MIRT2011273	hsa-miR-216b	CLIP-seq
MIRT1049172	hsa-miR-218	CLIP-seq
MIRT1049173	hsa-miR-219-1-3p	CLIP-seq
MIRT2546685	hsa-miR-299-3p	CLIP-seq
MIRT1049174	hsa-miR-3065-5p	CLIP-seq
MIRT1049175	hsa-miR-3129-3p	CLIP-seq
MIRT2546686	hsa-miR-3133	CLIP-seq
MIRT2546687	hsa-miR-3136-3p	CLIP-seq
MIRT1049176	hsa-miR-3140-3p	CLIP-seq
MIRT1049177	hsa-miR-3150a-3p	CLIP-seq
MIRT1049178	hsa-miR-3167	CLIP-seq
MIRT2546688	hsa-miR-320b	CLIP-seq
MIRT2546689	hsa-miR-320c	CLIP-seq
MIRT2546690	hsa-miR-320d	CLIP-seq
MIRT1049179	hsa-miR-320e	CLIP-seq
MIRT1049180	hsa-miR-337-3p	CLIP-seq
MIRT1049181	hsa-miR-340	CLIP-seq
MIRT2546691	hsa-miR-34a	CLIP-seq
MIRT1049182	hsa-miR-3613-3p	CLIP-seq
MIRT2011276	hsa-miR-3653	CLIP-seq
MIRT2011277	hsa-miR-3658	CLIP-seq
MIRT1049185	hsa-miR-3664-3p	CLIP-seq
MIRT2546692	hsa-miR-3671	CLIP-seq
MIRT2546693	hsa-miR-3672	CLIP-seq
MIRT2546694	hsa-miR-3688-5p	CLIP-seq
MIRT1049188	hsa-miR-3941	CLIP-seq
MIRT1049189	hsa-miR-410	CLIP-seq
MIRT1049190	hsa-miR-4260	CLIP-seq
MIRT1049191	hsa-miR-4262	CLIP-seq
MIRT1049192	hsa-miR-4282	CLIP-seq
MIRT2546695	hsa-miR-4429	CLIP-seq
MIRT1049194	hsa-miR-4450	CLIP-seq
MIRT1049196	hsa-miR-4470	CLIP-seq
MIRT2546696	hsa-miR-4471	CLIP-seq
MIRT2546697	hsa-miR-4495	CLIP-seq
MIRT2546698	hsa-miR-4496	CLIP-seq
MIRT2546699	hsa-miR-449a	CLIP-seq
MIRT2546700	hsa-miR-449b	CLIP-seq
MIRT2546701	hsa-miR-4503	CLIP-seq
MIRT2546702	hsa-miR-4506	CLIP-seq
MIRT2546703	hsa-miR-4517	CLIP-seq
MIRT1049197	hsa-miR-4518	CLIP-seq
MIRT2011284	hsa-miR-4540	CLIP-seq
MIRT2546704	hsa-miR-4633-5p	CLIP-seq
MIRT2546705	hsa-miR-4642	CLIP-seq
MIRT2546706	hsa-miR-4648	CLIP-seq
MIRT2546707	hsa-miR-4653-3p	CLIP-seq
MIRT2546708	hsa-miR-4654	CLIP-seq
MIRT1049200	hsa-miR-4659a-3p	CLIP-seq
MIRT1049201	hsa-miR-4659b-3p	CLIP-seq
MIRT1049202	hsa-miR-466	CLIP-seq
MIRT2546709	hsa-miR-4666-5p	CLIP-seq
MIRT1049205	hsa-miR-4672	CLIP-seq
MIRT1049206	hsa-miR-4688	CLIP-seq
MIRT1049207	hsa-miR-4698	CLIP-seq
MIRT1049208	hsa-miR-4699-5p	CLIP-seq
MIRT1049210	hsa-miR-4708-5p	CLIP-seq
MIRT1049213	hsa-miR-4735-5p	CLIP-seq
MIRT2546711	hsa-miR-4769-3p	CLIP-seq
MIRT2546712	hsa-miR-4769-5p	CLIP-seq
MIRT1049216	hsa-miR-4770	CLIP-seq
MIRT2011289	hsa-miR-4773	CLIP-seq
MIRT2546713	hsa-miR-4802-3p	CLIP-seq
MIRT1049220	hsa-miR-499a-5p	CLIP-seq
MIRT1049221	hsa-miR-505	CLIP-seq
MIRT1049222	hsa-miR-511	CLIP-seq
MIRT1049223	hsa-miR-513a-3p	CLIP-seq
MIRT1049226	hsa-miR-518a-5p	CLIP-seq
MIRT1049227	hsa-miR-527	CLIP-seq
MIRT2546715	hsa-miR-532-5p	CLIP-seq
MIRT2011290	hsa-miR-548aa	CLIP-seq
MIRT2011291	hsa-miR-548ad	CLIP-seq
MIRT1049229	hsa-miR-548ae	CLIP-seq
MIRT1049230	hsa-miR-548aj	CLIP-seq
MIRT1049231	hsa-miR-548am	CLIP-seq
MIRT2546716	hsa-miR-548c-3p	CLIP-seq
MIRT2546717	hsa-miR-548e	CLIP-seq
MIRT2546718	hsa-miR-548f	CLIP-seq
MIRT2546719	hsa-miR-548m	CLIP-seq
MIRT1049234	hsa-miR-548x	CLIP-seq
MIRT1049236	hsa-miR-549	CLIP-seq
MIRT1049237	hsa-miR-561	CLIP-seq
MIRT1049238	hsa-miR-576-5p	CLIP-seq
MIRT1049239	hsa-miR-577	CLIP-seq
MIRT1049241	hsa-miR-587	CLIP-seq
MIRT1049243	hsa-miR-607	CLIP-seq
MIRT2546720	hsa-miR-643	CLIP-seq
MIRT1049246	hsa-miR-767-5p	CLIP-seq
MIRT1049247	hsa-miR-876-5p	CLIP-seq
MIRT2546721	hsa-miR-885-5p	CLIP-seq
MIRT2546722	hsa-miR-889	CLIP-seq
MIRT1049248	hsa-miR-890	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFIC	Activation	11245470

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11748232
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	19158276
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19158276
GO:0000400	Function	Four-way junction DNA binding	ISS
GO:0000405	Function	Bubble DNA binding	ISS
GO:0000793	Component	Condensed chromosome	IDA	12925773
GO:0000793	Component	Condensed chromosome	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19158276
GO:0001530	Function	Lipopolysaccharide binding	IDA	21660935
GO:0001654	Process	Eye development	IEA
GO:0001773	Process	Myeloid dendritic cell activation	IEA
GO:0001773	Process	Myeloid dendritic cell activation	ISS
GO:0001786	Function	Phosphatidylserine binding	IDA	18768881
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002218	Process	Activation of innate immune response	IDA	24971542
GO:0002250	Process	Adaptive immune response	IEA
GO:0002270	Process	Plasmacytoid dendritic cell activation	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002318	Process	Myeloid progenitor cell differentiation	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002407	Process	Dendritic cell chemotaxis	ISS
GO:0002437	Process	Inflammatory response to antigenic stimulus	IEP	19841752
GO:0002643	Process	Regulation of tolerance induction	IDA	18631454
GO:0002643	Process	Regulation of tolerance induction	IEA
GO:0002840	Process	Regulation of T cell mediated immune response to tumor cell	IEA
GO:0002840	Process	Regulation of T cell mediated immune response to tumor cell	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	IDA	17803946
GO:0003684	Function	Damaged DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	ISS
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	ISS
GO:0003697	Function	Single-stranded DNA binding	ISS
GO:0003713	Function	Transcription coactivator activity	IDA	19223331
GO:0003714	Function	Transcription corepressor activity	IDA	11748232
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	ISS
GO:0005178	Function	Integrin binding	IDA	20826760
GO:0005515	Function	Protein binding	IPI	8006019, 9472015, 11748232, 15014079, 15379539, 19505873, 20819940, 23063560, 23303669, 24474694, 25416956, 28514442, 29721183, 31694235, 32296183, 32814053, 32867128, 33961781, 35239449
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	25595774
GO:0005615	Component	Extracellular space	IDA	19841752
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8339930, 19223331
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	35239449
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005980	Process	Glycogen catabolic process	IEA
GO:0006259	Process	DNA metabolic process	IEA
GO:0006265	Process	DNA topological change	ISS
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006302	Process	Double-strand break repair	ISS
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	ISS
GO:0006310	Process	DNA recombination	IEA
GO:0006310	Process	DNA recombination	ISS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IDA	23146691
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	22370717
GO:0008289	Function	Lipid binding	IEA
GO:0008301	Function	DNA binding, bending	IMP	19223331
GO:0008301	Function	DNA binding, bending	ISS
GO:0009986	Component	Cell surface	IDA	19841752
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	IMP	20819940
GO:0010596	Process	Negative regulation of endothelial cell migration	IEA
GO:0010858	Function	Calcium-dependent protein kinase regulator activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016829	Function	Lyase activity	IDA	17803946
GO:0017053	Component	Transcription repressor complex	IDA	19158276
GO:0017055	Process	Negative regulation of RNA polymerase II transcription preinitiation complex assembly	IDA	8006019
GO:0019958	Function	C-X-C chemokine binding	IDA	22370717
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030295	Function	Protein kinase activator activity	IEA
GO:0030324	Process	Lung development	IEA
GO:0031175	Process	Neuron projection development	ISS
GO:0031507	Process	Heterochromatin formation	IGI	19158276
GO:0032072	Process	Regulation of restriction endodeoxyribonuclease activity	IDA	17803946
GO:0032392	Process	DNA geometric change	ISS
GO:0032425	Process	Positive regulation of mismatch repair	IDA	15014079
GO:0032689	Process	Negative regulation of type II interferon production	IDA	22473704
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IDA	12765338
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	22473704
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	15944249
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	12765338, 26961863
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	26961863
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	12765338
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0033151	Process	V(D)J recombination	IDA	9166431
GO:0034137	Process	Positive regulation of toll-like receptor 2 signaling pathway	IEA
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IEA
GO:0034165	Process	Positive regulation of toll-like receptor 9 signaling pathway	ISS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035711	Process	T-helper 1 cell activation	IDA	22473704
GO:0035767	Process	Endothelial cell chemotaxis	IEA
GO:0035868	Component	Alphav-beta3 integrin-HMGB1 complex	IDA	20826760
GO:0042056	Function	Chemoattractant activity	ISS
GO:0042104	Process	Positive regulation of activated T cell proliferation	IMP	15944249
GO:0043005	Component	Neuron projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	19800306
GO:0043277	Process	Apoptotic cell clearance	IDA	18768881
GO:0043371	Process	Negative regulation of CD4-positive, alpha-beta T cell differentiation	IDA	22473704
GO:0043388	Process	Positive regulation of DNA binding	IDA	11748232, 19223331
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	12765338
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	28276476
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	23148224
GO:0045063	Process	T-helper 1 cell differentiation	IMP	15944249
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IEA
GO:0045819	Process	Positive regulation of glycogen catabolic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19223331
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	12765338
GO:0046598	Process	Positive regulation of viral entry into host cell	IMP	33147444
GO:0048018	Function	Receptor ligand activity	IDA	17568691
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048468	Process	Cell development	IEA
GO:0050786	Function	RAGE receptor binding	ISS
GO:0050792	Process	Regulation of viral process	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051052	Process	Regulation of DNA metabolic process	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19223331
GO:0070182	Function	DNA polymerase binding	IDA	17803946
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	22370717
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	22370717
GO:0090303	Process	Positive regulation of wound healing	IEA
GO:0097100	Function	Supercoiled DNA binding	ISS
GO:0097350	Process	Neutrophil clearance	IDA	18768881
GO:0098761	Process	Cellular response to interleukin-7	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	19223331
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1903706	Process	Regulation of hemopoiesis	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905455	Process	Positive regulation of myeloid progenitor cell differentiation	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IMP	28276476
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IDA	26961863
GO:2000426	Process	Negative regulation of apoptotic cell clearance	IDA	20826760
GO:2000819	Process	Regulation of nucleotide-excision repair	IEA
GO:2001200	Process	Positive regulation of dendritic cell differentiation	IMP	15944249

Other IDs

• MIM: 163905
• HGNC: 4983
• e!Ensembl: ENSG00000189403

Protein

• UniProt ID: P09429
• Protein name: High mobility group protein B1 (High mobility group protein 1) (HMG-1)
• Protein function: Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chrom
• PDB: 2LY4, 2RTU, 2YRQ, 6CG0, 6CIJ, 6CIK, 6CIL, 6CIM, 6OEM, 6OEN, 6OEO, 8I9M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09011	HMG_box_2	6 → 78	HMG-box domain	Domain
  PF00505	HMG_box	95 → 163	HMG (high mobility group) box	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Expressed in platelets (PubMed:11154118). {ECO:0000269|PubMed:11154118}.
• Sequence:

  MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
  EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
  SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
  SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

• Sequence length: 215

Pathways

KEGG:

Base excision repair
Autophagy - animal
Necroptosis
Neutrophil extracellular trap formation

Reactome:

Apoptosis induced DNA fragmentation
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Regulation of TLR by endogenous ligand
Neutrophil degranulation
Advanced glycosylation endproduct receptor signaling
TRAF6 mediated NF-kB activation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Brachyphalangy, polydactyly, and tibial aplasia/hypoplasia	Pathogenic	rs2500460578, rs2500460631	RCV002508858 RCV002508859	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HMGB1-associated disorder	Likely pathogenic	rs2500473984	RCV003448547	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRACHYPHALANGY, POLYDACTYLY, AND TIBIAL APLASIA-HYPOPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HMGB1-related Developmental delay and microcephaly	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HMGB1-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29041001		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	23393335		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25954971		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	19451748, 28440506, 28618057, 28754974, 28755135, 28894846, 29393354, 29511434, 30136704, 30365121, 30537729, 30947809		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18425372		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29745087, 31399104		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	31831860		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23467607, 26042604, 26840258		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15789216		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	24928512, 31731454		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25014664		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	23041135		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31284269		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	29701897, 31739216		★☆☆☆☆ Found in Text Mining only
Alopecia universalis	Alopecia	BEFREE	30666488		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	27616297		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27553758	Stimulate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	31505255		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26052716		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30210286, 30782181		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplasia	Anaplasia	BEFREE	31558702		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30333099		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	25602579, 29146189		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	33318474	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22718861, 28374746, 29296182		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	14871456, 26916160		★☆☆☆☆ Found in Text Mining only
Anterior Cruciate Ligament Injuries	Anterior cruciate ligament injury	Pubtator	31727431	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	29410969, 30923525		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	30923525	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	27908811	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	22365948, 26988591, 27908811		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	28024939		★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	26515875	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	31739216		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	21507211, 22947457	Associate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	22947457, 27922766		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11257120, 16807371, 17502242, 23564080, 25561283, 26202300, 26520896, 26605648, 26830200, 27840210, 28092162, 29129476, 29615103, 29951536, 30204458, 30271090, 30324654, 30371306, 30650406, 30867070, 30881312, 31204352		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17203009		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	18346273, 21871094, 27792788, 30704538	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27792788, 30704538, 31299881		★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	12456506	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34963488	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21871094	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12687539, 22809173	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20799933, 21532866, 21871094, 23488692, 24302816, 29200952, 31159863, 37964313	Associate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	28348451		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21380479, 24376296, 27035254, 32423802, 37793329	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22909167, 25726846, 26250770, 28391514, 28441990, 29257249, 29292841, 29545090, 29567318, 30502088, 31003767, 31525576, 31588340, 31825792, 31848359		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	25726846	Stimulate	★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	29774570		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11257120, 16807371, 17502242, 23564080, 25561283, 26202300, 26520896, 26605648, 26830200, 27840210, 28092162, 29129476, 29951536, 30204458, 30271090, 30324654, 30371306, 30650406, 30867070, 30881312, 31204352		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26830200, 27908811, 32157741, 32945389	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	26109393, 29595637		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	26109393, 29595637	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36124718	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30577568, 31320306		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19247800, 20546955, 23255728, 23467607, 24531836, 24705787, 24809802, 25344065, 25452436, 25879961, 26884867, 28363255, 28558055, 29410969, 29725415, 30024540, 30052706, 30396490, 30923525, 30998983, 31379812, 31606383		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19811284, 22809173, 24705787, 25879961, 26884867, 30923525, 35449863, 39505169	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	28363255		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28624051, 30827533		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16255056, 17895302, 31831860		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	31831860	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21532866		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	21532866	Stimulate	★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	29725248	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	31218684		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	31218684	Associate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	31218684		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	24651485, 29909604		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	31203140		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25150308, 26264279, 26629935, 26719575, 28376901, 29069735, 29113184, 29989024, 31015520, 31734579, 31848324		★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	28671243		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	20700129, 29330155, 30139371		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19143470		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10811891, 11911263, 12759333, 17979839, 22655796, 25501936, 26506894, 26720492, 26884867, 27241711, 27987020, 28382092, 28443467, 28533055, 29138861, 29725248, 29725415, 29844838, 30066873, 30161287, 30755598, 30930461, 30956264, 31584185, 31629951, 31664305		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22655796	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23019417, 25512109, 25983116, 26506894, 26720492, 26979828, 27241711, 28443467, 28533055, 29138861, 29725248, 30066873, 30930461, 31664305, 33191617, 33453094, 34267603, 35610613, 40613218	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29725248	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	30362259, 30407867		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	30508580		★☆☆☆☆ Found in Text Mining only
Bronchopneumonia	Bronchopneumonia	Pubtator	21223368	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	26982166		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	32397779	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	34922257	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	26515875	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20579387, 23298486, 24289579, 25652880, 27404728, 28423715, 30265210, 30970518, 32684831, 34374662, 40331953	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16118352, 22672360, 28000879		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	26106610	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	30588197	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21953322, 24510323, 24964964, 26194496, 27076788, 27836008, 28187002, 28403886, 28428710, 30265210, 33618227, 33661757, 34294368, 34497155, 34583662, 34743657, 35562734, 37554278, 40084261, 40331953	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22747650	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	31399104		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25150308, 26264279, 26629935, 26719575, 28376901, 29069735, 29113184, 29989024, 31015520, 31734579, 31848324		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22617774, 23467607, 24684392, 26896489, 27383136, 28885675, 29104475, 29246127, 29355524, 29665052, 29679570, 29725415, 29850505, 30744691, 31289487, 31504961		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24146279, 27249597, 27460076	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25060178	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18825712, 21947243, 24078503, 24289579, 26261503, 30964104, 33076532, 35712799	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23803172	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	28011467		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	30618088		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22331597, 22484401, 26397184, 27460076, 29844838, 30015957, 30058682, 30214593		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	25736854		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	26847839	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated with Left Ventricular Noncompaction	Dilated cardiomyopathy	Pubtator	39457420	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	24787265	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28671243, 30223272		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32739154, 32814439	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	28677786, 30194360, 30562142, 30732500		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28359357, 28870474, 29709462		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19005067, 20700129, 28671243, 29393445, 29867706, 31173318, 31257456, 31547018, 31628679		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27040385	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	28671243, 30028365		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19005067, 22529378, 23288172, 25589753, 27501713, 28408707, 28584116, 28645523, 29054968, 29201182, 29478057, 30015578, 30139371, 30217406, 30417405, 31059808, 31105025, 31366550		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	19005067		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	28476896, 36479843	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	28671243		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27829233, 27959427, 28000879, 29472602, 30962261		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	22127462, 26084608, 27828735		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27829233, 28000879, 28693148, 29472602, 30962261		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	26250770, 28441990		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	16255056, 17895302		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25014664		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	23041135		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25805932		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25805932, 36142453, 40686460	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	30177842		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	29703854		★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Choledochal Cyst	BEFREE	29909604		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	29703854		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29774570		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	Pubtator	25385222	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	25416861, 28555513		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	22361176		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	19819342, 25503556, 33776579	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18317568, 29922171		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29558367		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25726846, 28287180, 29078091, 30128028, 31129918, 31769590		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28209360		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	24504744, 28685526		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	23883808		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31105025		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29768967, 31430517		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32681213	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19686046	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	27553758	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25127031, 27572454, 27670944, 28108937, 28338748, 30227219, 30894054		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15051925, 16118352, 16424007, 19506549, 22750245, 25385285, 25434832, 29226325, 29257231, 30066846, 30716337, 30942231		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	16118352		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16118352	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12579287, 19898867, 21204727, 24362470, 25275029, 25434832, 25511739, 25778491, 27220399, 27456356, 27834305, 29033587, 29119054, 29246127, 29535803, 30066846, 30258050, 30456802, 30653121, 31677065, 31707381		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16118352, 19506549, 20846416, 22496788, 24681824, 25778491, 25986235, 26001393, 27456356, 30653121, 33122771, 35354479, 35408786, 36131027, 36811212, 37945630, 38200714, 40468720	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16951227		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	20943459, 27973467, 28082516		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28934735		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	24651485, 29909604		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23708738, 28092162, 31646380		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21947243, 24289579, 30122942, 30123419, 30644098		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24371373, 25966225, 26498282, 26520896, 28408707, 28427050, 29041001, 29115425, 29887944, 29940562, 31566720		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25966225, 28408707, 28427050, 29041001, 29444778, 29940562, 31566720		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32673514, 38275751	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25966225, 28408707, 28427050, 29041001, 29704473, 29940562, 31566720		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	23883808, 25772690		★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	26669670		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33939645	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21788990		★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	28415958		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22314397, 26760176, 27585400, 30964354		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	30964354	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29391442		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12687539, 20799933, 24556692, 24905701, 26082301, 28474284, 28844955, 29804557, 30535473, 30912672, 31228458, 31313630, 31454155, 31712854		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	31505255		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31505255		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27647532, 29195782, 30763674, 31011489, 31115516		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	35263889, 36383501	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24664804, 37166084	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	27868148, 28713916	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	27868148, 28713916, 29702284		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	27787879, 28713916, 29787749		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	15146429		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	15146429, 27537498	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20200317, 21656024, 22211895, 22217446, 25495026, 26542796, 28255157, 28695466, 29704473, 29920330, 29930087		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	20943659	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16037292, 20200317, 21656024, 22211895, 22217446, 25303153, 25495026, 26542796, 28092162, 28255157, 28352154, 28695466, 29704473, 29920330, 29930087, 31816325, 31835864		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21871056, 26454330, 33629304	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	33114431	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19455302, 23403945	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32853980	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20067962	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20463655	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23086037, 24073286, 34657898	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22217446, 29421543, 30410469, 31497226		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24073286, 27480067, 28101517, 28789654, 29920330, 30971430, 31129918, 31678553		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	23219582		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33565572	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22021706, 28641285, 29844451, 30342113, 30864227		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26454330	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28352154, 28647749, 28970183, 31816325		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	31298304, 34024230	Associate	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	30273982	Stimulate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29147614, 30988279		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30473885		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	LHGDN	18599803		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	26776504, 27467205, 31140293, 31848990		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	29349839, 29968395		★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	30613954		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28837629, 29610858		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	34510151	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyggve-Melchior-Clausen syndrome	Dyggve-Melchior-Clausen Disease	BEFREE	25400111		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	20956978		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31353785		★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	28858636		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	24664804	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	27868148, 29702284		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29555931, 31255677		★☆☆☆☆ Found in Text Mining only
Encephalomyelitis Acute Disseminated	Acute disseminated encephalomyelitis	Pubtator	33597947	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	29573352		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	30002362		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	32320818	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	33453094	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26261543, 28424555		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26261543, 26872033, 37967572, 38211843	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26872033, 29017437, 30183768, 31239500		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26872033	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29017437, 33815277, 36233009	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	34054124	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	34418984	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	22909167		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	37967572	Stimulate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	28094098		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis bullosa	Pubtator	28094098	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	21414994, 28167116, 28222432, 28504645, 28528202, 28675556, 28879430, 29031614, 29201182, 29247482, 29382328, 29393419, 30303442, 30417405, 30644560, 31105025, 31215389, 31229637, 31241711		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	36383501	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	36383501	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	31591845		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28125840		★☆☆☆☆ Found in Text Mining only
Episodic ataxia type 1	Episodic ataxia	BEFREE	30024944		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22331597, 27460076, 29844838, 30015957		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	24705787		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29968320, 30569171, 31498489		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29968320, 30569171, 31498489		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36907982	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21517111, 22544356, 26346170, 31831860, 36112883, 36335371, 40022250	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	BEFREE	30732222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	31410208		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25726846	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26525891, 29472523, 30616887		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29095942, 29774570		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	25319229, 28879430, 31591845		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26688180, 26818617, 27973467, 28611518, 28885322, 28903095, 29095942, 29403377, 29774570, 29907694, 29959419, 30258438, 31731454		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	29382328		★☆☆☆☆ Found in Text Mining only
FOCAL CORTICAL DYSPLASIA OF TAYLOR	Focal cortical dysplasia	BEFREE	29382328		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	29382328	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23298486	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24481712, 29745087		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	31404064		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	12727838		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	12727838		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	28686335, 29338161		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19789315, 24678590, 25097859, 25434832, 27663389, 30531692, 30719499, 31037147		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25097859, 30531692, 31037147, 36762036	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19143470, 19789315, 23220408, 24678590, 25097859, 25434832, 27663389, 30531692, 30719499, 31037147		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17975708		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25772485, 30503496, 31241346, 31421824		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25772485, 35872698	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	29982644		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	19819342	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26327693	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30860623		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33776579	Stimulate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	30826699		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	23711070		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	30217406		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28363255		★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	23349558	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27847340, 29957254, 30306212		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32277683	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23708738, 28092162		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	28337869		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	19819342		★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	31482731		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	29751935		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23964150, 26391982	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	23964150	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26656705	Associate	★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	27684473		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	18569640		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30538129		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	24420848, 25210949, 28641285, 29169909, 29195627, 30132524, 30175447, 30657854, 31353785		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	34639171	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	30767669		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	25228632		★☆☆☆☆ Found in Text Mining only
Hyperlysinemias	Hyperlipidemia	Pubtator	34068442	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25050807	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25050807, 25726846	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23269975, 25050807, 28036116, 30517029, 31011475, 31011489, 31597444		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	26847839, 33318474, 34108245	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27624778, 30704538	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30217406, 31362164		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23269975, 28407046, 28975966, 29615702		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28824731, 29795561, 31270920		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28824731, 32423802, 32857676	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	23269975, 25726846, 30610955		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	26656705	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28947753, 29348880, 29601597, 30853709, 31625460		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29031614, 29034441, 29768967, 29777754, 30271319, 30391757, 30712242, 31255677, 31430517, 31505255, 31678553		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	26048613		★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	26313914		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21788990, 24983978, 25127031, 26313692, 27572454, 27670944, 28012970, 28551086, 30227219, 30894054, 31082723		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	40468720	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32054355	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	34745571	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24664804, 29349839		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Intellectual developmental disorder	Pubtator	24664804	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30704538	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31497226		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	27512095, 37222533	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	31497226		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36248807	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	28374746		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	25805932		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28551086		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33011346	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23288172, 28645523, 29054968, 29245967, 30015578, 30139371, 31001089, 31431734, 31748020		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	29907203		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	27756498, 9336414		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	29236588, 29675369, 30407111, 31236343		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	35075374	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	39424461	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	23803172	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	27393275		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18317568		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18822317, 30132524		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	38401089	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	24646859, 28469775, 29258482, 29446739, 30379096		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	26261503	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	35280439	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	31313594	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15150086, 21864037, 25954971, 26081986, 31105999		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21068541, 21944254, 31928132, 33128580	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	21944254	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28478444, 30970518, 33128580	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28445844, 28478444, 29246646, 29872582, 30970518		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	28912641		★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	28294475		★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	CTD_human_DG	28294475		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	28408707		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	28408707		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18294942		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21953322, 22747650, 22754344, 23836405, 24510323, 24586525, 25681553, 25720799, 26194496, 26252226, 26499944, 27076788, 27191994, 28187002, 28216372, 28317284, 28370295, 28428710, 28474222, 29246127, 29441453, 29558367, 29651425, 29725415, 29803174, 29848691, 30198432, 30214576, 30265210, 30526680, 31158358, 31311167, 31568811, 31777261, 8968078		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	23964150	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	20943459		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	23390034	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	23390034	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	23706499, 25388426, 25498512, 28657371, 28694564, 29528759, 30979951, 31545489		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	27026438	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27557670, 27585400, 28039939		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29719300	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	27537498, 32393322	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22617774, 29104475, 29617336, 29850505, 32815451, 34552063, 37891619	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	9288769		★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	30938057		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	17895302, 18822317, 20110525		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	16255056	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19811284, 21532866, 22892043, 23270666, 23628898, 28485798, 30923525, 31494269, 37143669	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24082908	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	BEFREE	16255056, 17895302		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18822317, 20110525		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18822317, 19064698, 19247800, 20110525, 20546955, 21389264, 21532866, 22275109, 23616573, 24531836, 24809802, 26078984, 28245520, 28862243, 29615702, 30396490, 30923525, 30938057, 31299881, 31303606, 31619143		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	22275109, 26799193, 26822343, 30938057, 31619143, 31667864, 31806961		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	22348591, 27075010, 30537116, 31806961	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	22892043, 23270666	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	18822317, 20110525		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22544356, 25805932, 26001393, 26084608, 29725248, 30653121, 31399104, 33629304, 34068442, 35280439	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24146279, 24837834, 28347236, 36801636	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18569640		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	35765707	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	18569640		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	18569640		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	18569640		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	30378541		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	25589753		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	31284269	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	BEFREE	21414994		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29428215		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24431405, 27453164, 28186988, 28348451, 28713671, 30891101		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10811891, 11911263, 17979839, 22655796, 25501936, 26506894, 26720492, 26884867, 27241711, 27987020, 28382092, 28443467, 28533055, 29138861, 29725248, 29725415, 29844838, 30066873, 30161287, 30755598, 30930461, 30956264, 31584185, 31629951, 31664305		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28424555		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29968320, 30569171, 31498489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23042506, 29149457, 31443921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22617774, 23467607, 24684392, 26896489, 27383136, 28885675, 29104475, 29246127, 29355524, 29665052, 29679570, 29725415, 29850505, 30153900, 30744691, 31289487, 31504961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22331597, 22484401, 26397184, 29844838, 30015957, 30058682, 30214593		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26124331, 28374746, 29615080, 29753015, 30679086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15666359, 19148477, 22672360, 29113279, 29191973, 29845254, 30569456, 30674244, 30832473, 31410208, 31694235		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31190067		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16210872, 21953494, 22246223, 23298486, 24481712, 25821182, 26239046, 27116470, 28347236, 28574630, 30525214, 30635217, 30903594, 31266378		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26106610		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25150308, 26264279, 26629935, 26719575, 28376901, 29069735, 29113184, 29989024, 31015520, 31734579, 31848324		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12665595, 15150086, 15499602, 18569640, 19148477, 19506549, 19933377, 20123075, 21204727, 23023232, 23042506, 23298486, 23467607, 23723299, 23797067, 24213571, 24418846, 24481712, 24705787, 25168370, 25511739, 25720799, 25726846, 26499944, 26840258, 26884867, 26916160, 26925422, 26948869, 27116470, 27220399, 27456356, 27987020, 28011467, 28337869, 28415753, 28423715, 28424555, 28533055, 28536706, 28685526, 28706906, 28712719, 28920000, 28969092, 29027228, 29065965, 29191973, 29254158, 29257231, 29285100, 29312476, 29383986, 29387198, 29615080, 29651425, 29679570, 29721183, 29725415, 29728635, 29730397, 29844838, 29845254, 29848691, 29987748, 30049847, 30052706, 30080874, 30157958, 30198432, 30205729, 30214576, 30378541, 30643434, 30674244, 30679086, 30686534, 30738622, 30930461, 31092433, 31241346, 31284735, 31379812, 31399104, 31418171, 31421824, 31564569, 31625460, 31639457, 31727241, 31831860		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27829233, 28000879, 29472602, 30962261		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15051925, 16118352, 16424007, 19506549, 22750245, 29226325, 29257231, 30066846, 30716337, 30942231		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	18317568		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	LHGDN	18317568		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29147614		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25014664		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12665595		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18616526, 22170342, 31754297, 39266214	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19143470, 25051367, 28011467, 29079306		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27647532, 29195782, 30763674, 31011489, 31115516		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	26308799, 28186988, 28706906, 29356044		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	27453164	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	29356044, 32530527	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26656705	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25978344, 30614120		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29191973, 29845254, 30832473		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35244775	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	31365336	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	18720262		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30535242, 31611559		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	33023630	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27908811	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28295550, 30157958		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18644848, 23255728, 25879961, 29509323, 30013568, 30953953, 31606383, 31726376, 31728855		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18644848		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25879961, 35263889	Stimulate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	22405771, 25344065		★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	24705787	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30952643		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23403315	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21944254		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	21113057		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	21731608, 26498282, 27580416, 28716707, 28966323, 28966327, 29041001, 29169909, 30338842, 30859393, 31209243, 31280453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	28716707	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	39457420	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	24371373, 26498282, 29115425, 29887944, 30529040		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	28966323, 30269353		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	20110525, 26048613		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	34745571	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	24574111, 25503556, 31839751	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	25503556, 25772690		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18680137, 26382001, 26459833		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31675905	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	15793304, 20421386, 20799933, 21435605, 21538978, 21917150, 23349558, 24336085, 25412314, 25906152, 28765610, 30338917, 34743657	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	23992566, 24832602	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	30618088		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	20007974, 30541786, 30618088, 31190184		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10471823, 10945639, 11578972, 12579287, 12727838, 12759333, 15051925, 15539404, 16118352, 17218606, 17979839, 18331236, 18519658, 19143470, 19639200, 19789315, 19933377, 20514411, 21642542, 21807636, 21917150, 21947243, 22366886, 22617774, 22747650, 23042506, 23152075, 23220408, 23318458, 23353043, 23467607, 23534754, 23546299, 23723299, 23836405, 24213571, 24418846, 24481712, 24510323, 24550226, 24679698, 25150308, 25275029, 25434832, 25639284, 25681553, 25720799, 25772485, 25821182, 26106610, 26118980, 26252226, 26506894, 26617792, 26719575, 26925422, 26948869, 27383136, 28274958, 28295550, 28342873, 28370295, 28374746, 28474222, 28533055, 28693148, 28727734, 28885675, 28968989, 29027228, 29113184, 29246127, 29254158, 29270668, 29558367, 29571949, 29630115, 29695918, 29741224, 29745087, 29803174, 29844348, 29844838, 29848691, 29989024, 30066846, 30122942, 30123419, 30157958, 30319638, 30530288, 30569171, 30619746, 30643519, 30719499, 30744691, 30832473, 30874449, 30930461, 30962261, 30988279, 31015520, 31058025, 31100066, 31105999, 31115587, 31186804, 31284735, 31324798, 31331356, 31426515, 31501954, 31600692, 31694235, 31741770, 31796433, 9578844		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	30719499		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	27936517, 31619143		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	27393275		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	23255728, 27899037, 30417405, 30953953		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19387923, 26397184, 26925422, 29551576, 30578841, 30643519		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	34889712	Associate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	31505255		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	20943659, 27553758, 32739154, 34415075	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28049142, 28280849, 29777754, 30712242, 31505255		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	23255728		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30179591, 31666085		★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	CTD_human_DG	27474498		★☆☆☆☆ Found in Text Mining only
Nevus Sebaceus of Jadassohn	Epidermal nevus syndrome	BEFREE	12687539		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26525891, 28551086, 29095942, 29298863, 31215394, 31731454		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19639200, 19933377, 24247270, 24998555, 25776482, 26040768, 26617792, 26840258, 28427045, 28727734, 28814907, 28885675, 29562957, 29630115, 30485686, 30744691, 31186804, 31252267, 31281467, 31410019		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29095942, 29298863, 29774570		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24073286, 27174706, 28619625, 29862569		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24073286, 32814439	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34657898	Stimulate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	23041135		★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	28858636		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	28647749		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	30647411		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20799933, 21871094, 24905701, 33174011	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29804557	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32602358	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	27320800	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27320800, 28810618, 30912672		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29884910		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	32096202	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24609901, 24752578, 25168370, 26397184, 26925422, 27012556, 28346809, 29251324, 29387198, 29471892, 29899164		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24609901, 24752578, 25168370, 26676883, 28346809, 29251324, 29899164, 32348630, 33015161, 35211755, 36801636, 39851222	Associate	★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	28555513		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22331597, 22484401, 26397184, 29844838, 30015957, 30058682, 30214593		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16036111, 24146279, 27249597, 36552889	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26124331, 28374746, 29615080, 29753015, 30679086		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	23318458		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33763295, 34374662	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35765707	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	19451748, 28440506, 28618057, 30537729, 31177924		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	31139836		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	28619625		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23023232, 28342873, 30530288		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28197072, 28280849, 29670828, 29676481, 30353300, 31105025		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29670828	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34745571	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal Nonkinesigenic Dyskinesia 1	Paroxysmal nonkinesigenic dyskinesia	BEFREE	25492101		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	29929491		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28209360, 28686335, 28966323, 29338161, 29531138, 31689812		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35844512	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28259568, 28789654, 28967436		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	28789654		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	26454330	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29421543, 30179591, 31105025, 31666085		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29421543, 30179591, 31666085		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28125840, 29259392, 31136205, 31421026		★☆☆☆☆ Found in Text Mining only
Pituitary Apoplexy	Pituitary Apoplexy	BEFREE	31366550		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28885675, 31639457		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	30732222		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	25228632, 30204458, 30964354		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30964354, 32054355	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32320818	Associate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	30923525		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	15146429		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	15146429, 27537498	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	29956737		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	23393335		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	23393335		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31505255		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29774570		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	25495026, 29259392, 31421026		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15666359, 19148477, 22672360, 29113279, 29191973, 29845254, 30569456, 30674244, 30832473, 31410208, 31694235		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	15666359		★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	15666359		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14534709, 15666359		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29845254	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31916466, 33023053, 33099950, 34350063, 36776524	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34182498	Inhibit	★☆☆☆☆ Found in Text Mining only
Protanomaly	Protanomaly	BEFREE	29328447		★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	intracranial hypertension	BEFREE	27899037		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	27859256		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27859256, 27943400, 28713916, 28769106		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28975966		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	28975966	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21380479, 24376296, 25726846, 32423802, 32857676	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37945630	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18441281		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25582705, 28339089, 28571757, 29212801, 29526883, 30370641, 30536600, 31270920		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	27616297		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	27899037		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	27220399, 29270668		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30122942, 30123419, 30644098		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27916681		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	27557670		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	30574754		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	23607598, 24370952, 29946009, 29970013, 30574754, 31111072		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	30574754		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	27434276, 30194360		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	19139725		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	LHGDN	19139725		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	31298304	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22655796, 24418846, 26118980, 28149773, 29328447, 31114354		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	24418846, 26118980, 34646884	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17640970		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12687539, 20799933, 21532866, 24556692, 24809802, 25545169, 26605648, 26782432, 27659403, 27756498, 28916968, 29200665, 29200952, 30254017, 30283452, 30412715, 31159863, 31433746		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17203009, 17597834		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	34445093	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	37713866	Stimulate	★☆☆☆☆ Found in Text Mining only
Ruptured Appendicitis	Appendicitis	BEFREE	27922766		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	28125840		★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	27897164	Associate	★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	30613954		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	32393322	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Peritonitis	Peritonitis	BEFREE	28680349		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	38218765	Associate	★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	38218765	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	12620891, 21762470, 21958433, 24370952, 26632390, 28628607, 35930298	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	14695889, 14871456, 16751357, 18577209, 19097991, 19451748, 20980161, 22047946, 23239822, 23797067, 24285082, 24370952, 24603876, 24809802, 25517228, 25947626, 26052716, 26224030, 26312770, 26605648, 26632390, 26721185, 26916160, 27106082, 27889435, 27939519, 27965385, 28001381, 28145661, 28338748, 28373035, 28434923, 28484719, 28587368, 28610995, 28628607, 28680349, 28724977, 28806702, 28912856, 28947753, 29085368, 29115544, 29127203, 29170136, 29190939, 29343555, 29361549, 29370247, 29484406, 29505782, 29520271, 29563120, 29599080, 29601597, 29680657, 29862569, 29941462, 29988587, 30134814, 30194360, 30235477, 30239421, 30250569, 30314759, 30379096, 30423384, 30463769, 30496780, 30660872, 30780033, 30797785, 30822402, 30840287, 30853709, 30881224, 30946496, 30971430, 31140293, 31215389, 31377749, 31498489, 31520992, 31602200, 31705327, 31767118, 31835864, 31848990		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	19265175, 23146691		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	23349558	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	16802368	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	28713916	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	16255056, 17895302, 20546955, 29728859		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	36479843	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29920330, 31678553		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	26979829	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	35244775	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	29617336	Associate	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	28614141		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophies of Childhood	Spinal muscular atrophy	Pubtator	35765703	Associate	★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	25549101		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 17	Spinocerebellar ataxia	Pubtator	25549101	Associate	★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	25510912		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21617715, 25639284, 28011467, 28423715, 30738622		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22544356, 29138861, 29567990, 29968320, 30755598, 30796203		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18616526, 28423715	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35280439	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29285100		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30619746		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	25230256		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29041001		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28446773, 28627626, 30233331, 30417405, 30986405, 31507379, 31802434		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26525891, 29095942, 29472523, 30616887		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16210872, 21953494, 22246223, 23298486, 24481712, 25821182, 26239046, 27116470, 28347236, 28574630, 30525214, 30635217, 30903594, 31266378		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17352266, 20579387, 23866030, 25572734, 25652880, 27116470, 28347236, 29728635, 29745087, 30292233, 31114162, 31266378, 31905926, 32329842, 34068442	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33629304	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	30647411		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	20090932	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22167233	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26823474, 28189859, 28415958, 28606778, 28671243, 29078973, 29434719, 30028365, 31226363, 31801411		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	LHGDN	12384917		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	21871094	Stimulate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	25545169		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30045975		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	30732222		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	31560698		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	29650693		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29595637, 34681935	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	24705787		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	25344065		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33926347	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26106610		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26106610		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26106610	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	28363255		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	30613954		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	26239046, 26629935, 29695918		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29725248, 30334817	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21788990		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26239046, 26629935, 30610817, 31848324, 34796446	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23353043, 26239046, 30610817		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24837834, 27829233, 29472602, 33176595, 33455114	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	31313594		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	28261206		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	25517228, 28709622		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24152910, 31336567, 32853980	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30045975		★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	25726846	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	20110525, 30732222		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	28587670, 31790283, 32734361	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	36474713	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30338842, 30516302		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	39457420	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	39457420	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	27787879, 30338917, 30998983		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	30338917, 30998983	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	27787879, 30338917, 30998983		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease Type 2	Von willebrand disorder	Pubtator	25365350	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	23041135		★☆☆☆☆ Found in Text Mining only