HLX (H2.0 like homeobox)

Gene

• Entrez ID: 3142
• Gene name: H2.0 like homeobox
• Gene symbol: HLX
• Synonyms (NCBI Gene): HB24, HLX1
• Chromosome: 1
• Chromosome location: 1q41

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052679	hsa-miR-1260b	CLASH	23622248
MIRT717649	hsa-miR-1276	HITS-CLIP	19536157
MIRT717648	hsa-miR-5582-5p	HITS-CLIP	19536157
MIRT717647	hsa-miR-3622a-5p	HITS-CLIP	19536157
MIRT717646	hsa-miR-645	HITS-CLIP	19536157
MIRT717645	hsa-miR-3670	HITS-CLIP	19536157
MIRT717644	hsa-miR-6878-5p	HITS-CLIP	19536157
MIRT717643	hsa-miR-3175	HITS-CLIP	19536157
MIRT717642	hsa-miR-1343-5p	HITS-CLIP	19536157
MIRT717641	hsa-miR-939-5p	HITS-CLIP	19536157
MIRT717640	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT717639	hsa-miR-4423-3p	HITS-CLIP	19536157
MIRT717638	hsa-miR-2110	HITS-CLIP	19536157
MIRT717637	hsa-miR-6810-5p	HITS-CLIP	19536157
MIRT717636	hsa-miR-3150a-3p	HITS-CLIP	19536157
MIRT717635	hsa-miR-6763-5p	HITS-CLIP	19536157
MIRT717634	hsa-miR-6857-5p	HITS-CLIP	19536157
MIRT717633	hsa-miR-450a-2-3p	HITS-CLIP	19536157
MIRT717632	hsa-miR-4260	HITS-CLIP	19536157
MIRT717631	hsa-miR-5572	HITS-CLIP	19536157
MIRT717649	hsa-miR-1276	HITS-CLIP	19536157
MIRT717648	hsa-miR-5582-5p	HITS-CLIP	19536157
MIRT717647	hsa-miR-3622a-5p	HITS-CLIP	19536157
MIRT717646	hsa-miR-645	HITS-CLIP	19536157
MIRT717645	hsa-miR-3670	HITS-CLIP	19536157
MIRT717644	hsa-miR-6878-5p	HITS-CLIP	19536157
MIRT717643	hsa-miR-3175	HITS-CLIP	19536157
MIRT717642	hsa-miR-1343-5p	HITS-CLIP	19536157
MIRT717641	hsa-miR-939-5p	HITS-CLIP	19536157
MIRT717640	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT717639	hsa-miR-4423-3p	HITS-CLIP	19536157
MIRT717638	hsa-miR-2110	HITS-CLIP	19536157
MIRT717637	hsa-miR-6810-5p	HITS-CLIP	19536157
MIRT717636	hsa-miR-3150a-3p	HITS-CLIP	19536157
MIRT717635	hsa-miR-6763-5p	HITS-CLIP	19536157
MIRT717634	hsa-miR-6857-5p	HITS-CLIP	19536157
MIRT717633	hsa-miR-450a-2-3p	HITS-CLIP	19536157
MIRT717632	hsa-miR-4260	HITS-CLIP	19536157
MIRT717631	hsa-miR-5572	HITS-CLIP	19536157
MIRT717649	hsa-miR-1276	HITS-CLIP	19536157
MIRT717648	hsa-miR-5582-5p	HITS-CLIP	19536157
MIRT717647	hsa-miR-3622a-5p	HITS-CLIP	19536157
MIRT717646	hsa-miR-645	HITS-CLIP	19536157
MIRT717645	hsa-miR-3670	HITS-CLIP	19536157
MIRT717644	hsa-miR-6878-5p	HITS-CLIP	19536157
MIRT717643	hsa-miR-3175	HITS-CLIP	19536157
MIRT717642	hsa-miR-1343-5p	HITS-CLIP	19536157
MIRT717641	hsa-miR-939-5p	HITS-CLIP	19536157
MIRT717640	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT717639	hsa-miR-4423-3p	HITS-CLIP	19536157
MIRT717638	hsa-miR-2110	HITS-CLIP	19536157
MIRT717637	hsa-miR-6810-5p	HITS-CLIP	19536157
MIRT717636	hsa-miR-3150a-3p	HITS-CLIP	19536157
MIRT717635	hsa-miR-6763-5p	HITS-CLIP	19536157
MIRT717634	hsa-miR-6857-5p	HITS-CLIP	19536157
MIRT717633	hsa-miR-450a-2-3p	HITS-CLIP	19536157
MIRT717632	hsa-miR-4260	HITS-CLIP	19536157
MIRT717631	hsa-miR-5572	HITS-CLIP	19536157
MIRT717649	hsa-miR-1276	HITS-CLIP	19536157
MIRT717648	hsa-miR-5582-5p	HITS-CLIP	19536157
MIRT717647	hsa-miR-3622a-5p	HITS-CLIP	19536157
MIRT717646	hsa-miR-645	HITS-CLIP	19536157
MIRT717645	hsa-miR-3670	HITS-CLIP	19536157
MIRT717644	hsa-miR-6878-5p	HITS-CLIP	19536157
MIRT717643	hsa-miR-3175	HITS-CLIP	19536157
MIRT717642	hsa-miR-1343-5p	HITS-CLIP	19536157
MIRT717641	hsa-miR-939-5p	HITS-CLIP	19536157
MIRT717640	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT717639	hsa-miR-4423-3p	HITS-CLIP	19536157
MIRT717638	hsa-miR-2110	HITS-CLIP	19536157
MIRT717637	hsa-miR-6810-5p	HITS-CLIP	19536157
MIRT717636	hsa-miR-3150a-3p	HITS-CLIP	19536157
MIRT717635	hsa-miR-6763-5p	HITS-CLIP	19536157
MIRT717634	hsa-miR-6857-5p	HITS-CLIP	19536157
MIRT717633	hsa-miR-450a-2-3p	HITS-CLIP	19536157
MIRT717632	hsa-miR-4260	HITS-CLIP	19536157
MIRT717631	hsa-miR-5572	HITS-CLIP	19536157
MIRT1048731	hsa-miR-3151	CLIP-seq
MIRT1048732	hsa-miR-3180	CLIP-seq
MIRT1048733	hsa-miR-3180-3p	CLIP-seq
MIRT1048734	hsa-miR-3196	CLIP-seq
MIRT1048735	hsa-miR-4676-5p	CLIP-seq
MIRT1048736	hsa-miR-503	CLIP-seq
MIRT1048737	hsa-miR-575	CLIP-seq
MIRT2546548	hsa-miR-1184	CLIP-seq
MIRT2546549	hsa-miR-34a	CLIP-seq
MIRT2546550	hsa-miR-34c-5p	CLIP-seq
MIRT2546551	hsa-miR-3672	CLIP-seq
MIRT2546552	hsa-miR-449a	CLIP-seq
MIRT2546553	hsa-miR-449b	CLIP-seq
MIRT2546554	hsa-miR-4669	CLIP-seq
MIRT1048735	hsa-miR-4676-5p	CLIP-seq
MIRT1048737	hsa-miR-575	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
POU5F1	Repression	17068183

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001889	Process	Liver development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007165	Process	Signal transduction	TAS	8094082
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0035265	Process	Organ growth	IEA
GO:0043565	Function	Sequence-specific DNA binding	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	9073066
GO:0045063	Process	T-helper 1 cell differentiation	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045627	Process	Positive regulation of T-helper 1 cell differentiation	IEA
GO:0045629	Process	Negative regulation of T-helper 2 cell differentiation	IEA
GO:0046622	Process	Positive regulation of organ growth	IEA
GO:0048484	Process	Enteric nervous system development	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA

Other IDs

• MIM: 142995
• HGNC: 4978
• e!Ensembl: ENSG00000136630

Protein

• UniProt ID: Q14774
• Protein name: H2.0-like homeobox protein (Homeobox protein HB24) (Homeobox protein HLX1)
• Protein function: Transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	277 → 333	Homeodomain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Low level in normal B and T-cells, high level in activated lymphocytes and monocytes. Also found in thymus, tonsil, bone marrow, developing vessels, and fetal brain.
• Sequence:

  MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFPLDPAAVKKPSFCIADILHAGVGDLGAA
  PEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYH
  HHHPQQQQQQQQPQQQQPPPPPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDR
  ILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPL
  NSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKY
  VTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADG
  EQDERSPSRSEGEAESESSDSESLDMAPSDTERTEGSERSLHQTTVIKAPVTGALITASS
  AGSGGSSGGGGNSFSFSSASSLSSSSTSAGCASSLGGGGASELLPATQPTASSAPKSPEP
  AQGALGCL

• Sequence length: 488

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIAPHRAGMATIC HERNIA, SHORT BOWEL, ASPLENIA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIAPHRAGMATIC HERNIA-SHORT BOWEL-ASPLENIA SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HLX-related disorder	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	7680402		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	7680402		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29581848		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	35693796	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	19038437		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19362357, 22303482		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15161049, 37719132	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19038437, 19362357		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37719132	Associate	★☆☆☆☆ Found in Text Mining only
Congenital absence of spleen	Asplenia	BEFREE	28898547		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	19459883, 28898547		★☆☆☆☆ Found in Text Mining only
Diaphragmatic hernia-short bowel-asplenia syndrome	Diaphragmatic Hernia-Short Bowel-Asplenia Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31141539		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	22014209	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	37719132	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29581848		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1375114, 31825998	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16902145		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26631039		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10207165		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16902145, 24067365		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	7680402		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15161049, 26631039		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	7680402		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23243425	Associate	★☆☆☆☆ Found in Text Mining only