Gene Gene information from NCBI Gene database.
Entrez ID 3141
Gene name Holocarboxylase synthetase
Gene symbol HLCS
Synonyms (NCBI Gene)
HCS
Chromosome 21
Chromosome location 21q22.13
Summary This gene encodes an enzyme that catalyzes the binding of biotin to carboxylases and histones. The protein plays an important role in gluconeogenesis, fatty acid synthesis and branched chain amino acid catabolism. Defects in this gene are the cause of hol
SNPs SNP information provided by dbSNP.
37
SNP ID Visualize variation Clinical significance Consequence
rs28934602 A>C Likely-pathogenic Missense variant, coding sequence variant, non coding transcript variant
rs119103227 A>C,G Uncertain-significance, likely-pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs119103228 C>T Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
rs119103229 G>A Pathogenic Non coding transcript variant, coding sequence variant, intron variant, genic downstream transcript variant, missense variant
rs119103230 C>T Pathogenic Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
262
miRTarBase ID miRNA Experiments Reference
MIRT718184 hsa-miR-3620-3p HITS-CLIP 19536157
MIRT718185 hsa-miR-6752-3p HITS-CLIP 19536157
MIRT718183 hsa-miR-6832-3p HITS-CLIP 19536157
MIRT718182 hsa-miR-6747-3p HITS-CLIP 19536157
MIRT718181 hsa-miR-4287 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000785 Component Chromatin IDA 14613969
GO:0003824 Function Catalytic activity IEA
GO:0004077 Function Biotin--[biotin carboxyl-carrier protein] ligase activity IBA
GO:0004077 Function Biotin--[biotin carboxyl-carrier protein] ligase activity IDA 7842009, 9630604, 14613969
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609018 4976 ENSG00000159267
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P50747
Protein name Biotin--protein ligase (EC 6.3.4.-) (Biotin apo-protein ligase) [Includes: Biotin--[methylmalonyl-CoA-carboxytransferase] ligase (EC 6.3.4.9); Biotin--[propionyl-CoA-carboxylase [ATP-hydrolyzing]] ligase (EC 6.3.4.10) (Holocarboxylase synthetase) (HCS); B
Protein function Biotin--protein ligase catalyzing the biotinylation of the 4 biotin-dependent carboxylases acetyl-CoA-carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, and methylcrotonyl-CoA carboxylase. {ECO:0000269|PubMed:10590022, ECO:0000269|Pub
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09825 BPL_N 271 477 Biotin-protein ligase, N terminal Family
PF03099 BPL_LplA_LipB 471 603 Biotin/lipoate A/B protein ligase family Domain
PF02237 BPL_C 669 718 Biotin protein ligase C terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed (PubMed:7753853, PubMed:7842009). Mostly expressed in muscle, placenta and to a lower extent in the brain, kidney, pancreas, liver and lung (PubMed:7842009). {ECO:0000269|PubMed:7753853, ECO:0000269|PubMed:7842009}.
Sequence
MEDRLHMDNGLVPQKIVSVHLQDSTLKEVKDQVSNKQAQILEPKPEPSLEIKPEQDGMEH
VGRDDPKALGEEPKQRRGSASGSEPAGDSDRGGGPVEHYHLHLSSCHECLELENSTIESV
KFASAENIPDLPYDYSSSLESVADETSPEREGRRVNLTGKAPNILLYVGSDSQEALGRFH
EVRSVLADCVDIDSYILYHLLEDSALRDPWTDNCLLLVIATRESIPEDLYQKFMAYLSQG
GKVLGLSSSFTFGGFQVTSKGALHKTVQNLVFSKADQSEVKLSVLSSGCRYQEGPVRLSP
GRLQGHLENEDKDRMIVHVPFGTRGGEAVLCQVHLELPPSSNIVQTPEDFNLLKSSNFRR
YEVLREILTTLGLSCDMKQVPALTPLYLLSAAEEIRDPLMQWLGKHVDSEGEIKSGQLSL
RFVSSYVSEVEITPSCIPVVTNMEAFSSEHFNLEIYRQNLQTKQLGKVIL
FAEVTPTTMR
LLDGLMFQTPQEMGLIVIAARQTEGKGRGGNVWLSPVGCALSTLLISIPLRSQLGQRIPF
VQHLMSVAVVEAVRSIPEYQDINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGC
GFN
VTNSNPTICINDLITEYNKQHKAELKPLRADYLIARVVTVLEKLIKEFQDKGPNSVL
PLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQEGGEVVTVHPDGNSFDMLRNL
ILPKRR
Sequence length 726
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Biotin metabolism
Metabolic pathways
  Biotin transport and metabolism
Defective HLCS causes multiple carboxylase deficiency
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Holocarboxylase synthetase deficiency Likely pathogenic; Pathogenic rs2090068896, rs2145732111, rs1198548955, rs2065031709, rs1342457304, rs2146525207, rs1164174059, rs760372711, rs2146336447, rs2146336516, rs937407062, rs1015594025, rs1288789420, rs776431253, rs2146528200
View all (144 more)
RCV003032931
RCV001376817
RCV001377994
RCV001381046
RCV001389480
View all (159 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ovarian serous cystadenocarcinoma Pathogenic rs753887925 RCV005887198
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Uncertain significance; Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alopecia Alopecia HPO_DG
★☆☆☆☆
Found in Text Mining only
Angina, Unstable Intermediate coronary syndrome BEFREE 31452690
★☆☆☆☆
Found in Text Mining only
Anorexia Anorexia HPO_DG
★☆☆☆☆
Found in Text Mining only
Biotinidase Deficiency Biotinidase Deficiency BEFREE 18845537
★☆☆☆☆
Found in Text Mining only
Biotinidase Deficiency Biotinidase deficiency Pubtator 3920902, 7102675 Associate
★☆☆☆☆
Found in Text Mining only
Borderline Personality Disorder Borderline personality disorder Pubtator 24367640 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 17291666
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 21303649 Associate
★☆☆☆☆
Found in Text Mining only
Chediak-Higashi Syndrome Chediak-Higashi Syndrome BEFREE 31305294
★☆☆☆☆
Found in Text Mining only
Chondrosarcoma Chondrosarcoma BEFREE 11458815, 15118855, 24324705, 28865129, 8200849
★☆☆☆☆
Found in Text Mining only