HLA-G (major histocompatibility complex, class I, G)

Gene

• Entrez ID: 3135
• Gene name: Major histocompatibility complex, class I, G
• Gene symbol: HLA-G
• Synonyms (NCBI Gene): MHC-G
• Chromosome: 6
• Chromosome location: 6p22.1
• Summary: HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placenta

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000297	hsa-miR-148a-3p	Luciferase reporter assay	17847008
MIRT000295	hsa-miR-148b-3p	Luciferase reporter assay	17847008
MIRT000293	hsa-miR-152-3p	Luciferase reporter assay	17847008
MIRT731747	hsa-miR-152-5p	ELISA, Luciferase reporter assay, qRT-PCR	26187665
MIRT731747	hsa-miR-152-5p	ELISA, Luciferase reporter assay, qRT-PCR	26187665
MIRT000293	hsa-miR-152-3p	ELISA, Luciferase reporter assay, qRT-PCR	26627200
MIRT000293	hsa-miR-152-3p	ELISA, Luciferase reporter assay, qRT-PCR	26627200
MIRT735226	hsa-miR-744-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR, Flow cytometry	32571994
MIRT1048571	hsa-miR-1252	CLIP-seq
MIRT1048572	hsa-miR-2110	CLIP-seq
MIRT1048573	hsa-miR-3150a-3p	CLIP-seq
MIRT1048574	hsa-miR-4271	CLIP-seq
MIRT1048575	hsa-miR-4291	CLIP-seq
MIRT1048576	hsa-miR-4533	CLIP-seq
MIRT1048577	hsa-miR-4725-3p	CLIP-seq
MIRT1048578	hsa-miR-4747-5p	CLIP-seq
MIRT1048579	hsa-miR-509-3p	CLIP-seq
MIRT2011037	hsa-miR-513a-3p	CLIP-seq
MIRT2011038	hsa-miR-873	CLIP-seq
MIRT2243326	hsa-miR-1587	CLIP-seq
MIRT2243327	hsa-miR-224	CLIP-seq
MIRT2243328	hsa-miR-3616-5p	CLIP-seq
MIRT2243329	hsa-miR-3647-5p	CLIP-seq
MIRT2243330	hsa-miR-3663-5p	CLIP-seq
MIRT2243331	hsa-miR-4417	CLIP-seq
MIRT2243332	hsa-miR-4492	CLIP-seq
MIRT2243333	hsa-miR-4498	CLIP-seq
MIRT2243334	hsa-miR-4635	CLIP-seq
MIRT2243335	hsa-miR-4656	CLIP-seq
MIRT2243336	hsa-miR-4675	CLIP-seq
MIRT2243337	hsa-miR-4719	CLIP-seq
MIRT2243338	hsa-miR-4741	CLIP-seq
MIRT2243339	hsa-miR-526b	CLIP-seq
MIRT2243340	hsa-miR-541	CLIP-seq
MIRT2243341	hsa-miR-573	CLIP-seq
MIRT2243342	hsa-miR-593	CLIP-seq
MIRT2243343	hsa-miR-654-5p	CLIP-seq
MIRT2243344	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Unknown	11137218
GLI3	Repression	23592762
HIVEP2	Unknown	1409593
HSF1	Unknown	11005379
IRF1	Unknown	11087747
MYC	Activation	8206526
MYCN	Unknown	8895520
SP1	Unknown	11137218

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IDA	11290782
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002451	Process	Peripheral B cell tolerance induction	IDA	24453251
GO:0002474	Process	Antigen processing and presentation of peptide antigen via MHC class I	IEA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IDA	7584149, 8805247
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA
GO:0002645	Process	Positive regulation of tolerance induction	IMP	22802125
GO:0002666	Process	Positive regulation of T cell tolerance induction	IMP	20448110
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IDA	16366734, 19304799, 23184984
GO:0002767	Process	Immune response-inhibiting cell surface receptor signaling pathway	IDA	20702625
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IPI	20702625, 22802125
GO:0005515	Function	Protein binding	IPI	9640257, 10190900, 11520457, 12582157, 12853576, 12874224, 16366734, 16455647, 16809620, 17056715, 19583775, 22802125, 24018270, 24899623, 28348268
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	16366734
GO:0005769	Component	Early endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IDA	7584149, 11290782, 12582157
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006968	Process	Cellular defense response	TAS	9539768
GO:0009897	Component	External side of plasma membrane	IBA
GO:0012507	Component	ER to Golgi transport vesicle membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	16809620
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0031527	Component	Filopodium membrane	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20702625
GO:0033106	Component	Cis-Golgi network membrane	IDA	12582157
GO:0042130	Process	Negative regulation of T cell proliferation	IDA	20702625
GO:0042270	Process	Protection from natural killer cell mediated cytotoxicity	IDA	11290782
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	IDA	7584149, 8805247, 20122941
GO:0042610	Function	CD8 receptor binding	IDA	12853576
GO:0042612	Component	MHC class I protein complex	IEA
GO:0042802	Function	Identical protein binding	IPI	16455647, 18550825, 22802125, 28348268
GO:0042803	Function	Protein homodimerization activity	IDA	12874224, 22802125
GO:0042995	Component	Cell projection	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IMP	20448110
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	10190900
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IMP	12874224
GO:0050777	Process	Negative regulation of immune response	IC	22802125
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	24453251
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055038	Component	Recycling endosome membrane	TAS
GO:0060907	Process	Positive regulation of macrophage cytokine production	IDA	19304799
GO:0070207	Process	Protein homotrimerization	IDA	12874224
GO:0070317	Process	Negative regulation of G0 to G1 transition	IDA	24453251
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IEA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	16809620
GO:2000774	Process	Positive regulation of cellular senescence	IDA	23184984
GO:2001199	Process	Negative regulation of dendritic cell differentiation	IDA	20702625

Other IDs

• MIM: 142871
• HGNC: 4964
• e!Ensembl: ENSG00000204632

Protein

• UniProt ID: P17693
• Protein name: HLA class I histocompatibility antigen, alpha chain G (HLA G antigen) (MHC class I antigen G) [Cleaved into: Soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G)]
• Protein function: [Isoform 1]: Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface (PubMed:19304799, PubMed:23184984, PubMed:29262349). In complex with B2M/beta-2 microglobulin binds a l
• PDB: 1YDP, 2D31, 2DYP, 3BZE, 3CDG, 3CII, 3KYN, 3KYO, 6AEE, 6K60
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00129	MHC_I	25 → 203	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain
  PF07654	C1-set	211 → 290	Immunoglobulin C1-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in adult eye (PubMed:1570318). Expressed in immune cell subsets including monocytes, myeloid and plasmacytoid dendritic cells and regulatory T cells (Tr1)(at protein level) (PubMed:20448110). Secreted by follicular dendritic
• Sequence:

  MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRF
  DSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQ
  WMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQR
  RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
  WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
  SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

• Sequence length: 338

Pathways

KEGG:

Endocytosis
Phagosome
Cellular senescence
Cell adhesion molecules
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Viral carcinogenesis
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Reactome:

ER-Phagosome pathway
Endosomal/Vacuolar pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Interferon gamma signaling
Interferon alpha/beta signaling
Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Post-COVID-19 disorder	Likely risk allele	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	18059484		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	8795141, 8988550		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16616377		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30619504		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29602958		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	27015561, 30009537		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30616805		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	27527921		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	30414459		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29603194		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	29603194		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	19775370		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	30150635		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25829020		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25854712		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30616805		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27778096		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15611928, 16257632, 17847008, 19951440, 23534973, 24033084, 25266681, 28303134, 29527207, 30142579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	17847008		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	12560562		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28627421, 30763769		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25451607, 28627421		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12783978, 15993714, 16280356, 18797896, 19884219, 21082935, 22489942, 24639245, 26634551, 26667769, 27331404, 28135606, 30014615		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11781245		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18499249, 19141398		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	17067446		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17257316, 26519864		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26889902		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	22489942		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	22489942		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	23246584, 29737889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23246584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16734140		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	27449667		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11971028		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11857488, 12392849, 16541284, 20196818, 24164707, 24240586, 25063027, 25735953, 26320511, 26754763, 29076586, 30945586, 31759373		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	15611928, 19951440		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14555519, 21972088		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11549573		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14639610, 18498645, 21858813, 23228395, 24987709, 29499226, 31382533		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	17854427		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	17854427		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16569678, 20823837, 25500250		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22095460, 23228396, 24262586		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	27998803		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22095460, 23228396, 24262586		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11061559, 11254939, 15514928, 15578261, 17400064, 2254882, 29198970, 30334453, 31322727, 8595132		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	24131018, 24929145		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23663527, 30794652		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14602240, 18288133, 18499249, 19141398		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	15466928, 18051955, 18499249		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24196788, 29296176, 9855710		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	9855710		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21726203, 26752414, 27245757, 28415627, 29296176, 30006120, 30234020, 31748960, 9855710		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	9855710		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	21762747, 28929613		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11559559, 12547708, 12874014, 14602239, 17707652, 17982631, 18721274, 19531101, 22640987, 27057628, 31451484		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22395526		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22395526		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22395526		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17446213, 25577194, 29588183		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17446213		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25989360, 26934639		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20097242		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	LHGDN	17981049		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18830248, 26492519, 26883941, 27080982		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25620080		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	24759678		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	14555519		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	11766889, 14985477, 16280356, 16867913, 17026466, 24383466, 27596021, 27651521, 29941324		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30414280		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	16311290, 29234882		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	17509578, 17953947		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24987709, 31382533		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	12547708		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22080860		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22080860		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29464090		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24036009, 30825834		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	27914217		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11971028, 23219427, 28045999		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11971028, 23219427, 23220408, 28045999		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11971028		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	17897304, 18528424		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	12783978, 9777333		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	12783978, 22930786		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	21082935, 21399669, 24800261, 27652273		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	11781245		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	18257895		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29602958		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17446213		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17446213		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29588183		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	28941745		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31735441		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	18331529		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	18331529		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	21663783		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	24131018, 24929145		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	27800497		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12681364, 18823661, 29602958, 30334453		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	14628085		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18494931		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21696824		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21744989, 23506091, 25772038, 27706615		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17673327		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18295670		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18380776, 19318395, 19884219, 21188486, 21395561, 23678155, 25326335, 25454623, 25762019, 27331404		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31291846		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11781245, 21082935		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	14592815		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	18608865		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	29388862		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	29388862		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	14602240		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	16541284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11857488, 12392849, 20196818, 24164707, 24240586, 25063027, 25735953, 26320511, 26754763, 29076586, 30945586, 31759373		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30414280		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22080860		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11549573		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14639610, 18498645, 21858813, 23228395, 24987709, 29499226		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26889902		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21726203, 26627200		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27914217		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14639610, 14711057, 16455204, 17072500, 17400063, 17689555, 19038339, 19135113, 19141398, 20047640, 20434034, 21063893, 21482709, 21499927, 21792710, 21858813, 22465194, 23347068, 24800261, 24839609, 25461612, 25735953, 26776459, 28045999, 28233298, 28470686, 28740236, 29085437, 29131154, 29464090, 29499226, 30014615, 30234020, 30574154, 30802770, 31489189, 31759373, 8795141, 8988550, 9855710		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22095460, 23228396, 24262586		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24196788, 29296176, 9855710		★☆☆☆☆ Found in Text Mining only
Malignant Vaginal Neoplasm	Malignant Vaginal Neoplasm	BEFREE	23228396		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11857488, 12392849		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	30942640		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	14639610		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10092548, 10213506, 10479054, 10841284, 10958353, 11726606, 14602237, 14639610, 17072500, 17400064, 17689098, 17689555, 27999823, 28045999, 28882620, 30574154		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12115588, 17689098		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	11719594, 11925408, 12721954, 15191524, 16426245, 16501035, 18480096, 18509163, 20017810, 20149831, 20228379, 21354454, 22537754, 22563925, 24346507, 25637667, 26061487, 26973020, 28702027, 28923404, 29280596, 29481987, 29797531, 30717132		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	18976687		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	18976687		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	28711734		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	30942640		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16243800		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18288133, 24850305		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15652415, 16123145, 17462509, 20636826, 22922127, 26711580, 27771469, 30128676, 30482463		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16459714, 18208868		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	22922127		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	18851734		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	30763769		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	17371944		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	24741599		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10189383, 10213506, 10225437, 10479062, 10958353, 11216872, 11549573, 11559559, 11726606, 11857488, 12392849, 12547505, 14555519, 14602237, 15069585, 15514928, 16541284, 17072500, 17400064, 17707652, 18498645, 19038339, 20434034, 21063893, 21482709, 21858813, 21972088, 22144141, 22253825, 23219427, 23228395, 23261411, 23265140, 23499774, 23772974, 24196788, 24297791, 24800261, 24850305, 25500427, 25829020, 26460949, 26633805, 27895918, 27914217, 27998803, 28233298, 28882620, 29296176, 29464090, 29499226, 30006120, 30414280, 30574154, 30616805, 30802770, 30859089, 30945586, 31489189, 31694909		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	17616704		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22115424, 22253825		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26711580		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31765953		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21726203, 27517300		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	14639610, 21858813, 29499226		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17681474, 17846022, 18498645		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18498645, 21858813, 23228395		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22930786, 23261411, 27914217		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	30859089		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	LHGDN	14700594		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	14700594		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	18059484		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26889902		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	16616377		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18797896		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	11559559, 12547708, 14639610		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11559559, 12547708, 12874014, 14602239, 14639610, 17707652, 17982631, 18721274, 19531101, 22640987, 27057628		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12874014, 17707652, 17982631, 18721274		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	26934639		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23157549		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16906016, 18331529, 21253738, 23228398, 24580026, 24957665, 25326335, 25656292, 27778096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16916651		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	LHGDN	18782112		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	16933468, 17462509		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	16933468		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27567986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	23228394, 30158921		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	14602240		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	14602238, 17981049		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	27449667		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18024326		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	30030939		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23772974, 31016793		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30859089		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	30907063		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21726203, 26627200		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	24741608		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	23228394, 25847615, 30158921		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11781245		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23261411, 27914217		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27914217		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17446213, 29588183		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17446213		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	11726606		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	15191524, 19811467		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	21847675, 31505868		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	21847675, 31505868		★☆☆☆☆ Found in Text Mining only