ANXA13 (annexin A13)

Gene

• Entrez ID: 312
• Gene name: Annexin A13
• Gene symbol: ANXA13
• Synonyms (NCBI Gene): ANX13, ISA
• Chromosome: 8
• Chromosome location: 8q24.13
• Summary: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of this gene has not yet be

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT786408	hsa-miR-1	CLIP-seq
MIRT786409	hsa-miR-105	CLIP-seq
MIRT786410	hsa-miR-1227	CLIP-seq
MIRT786411	hsa-miR-206	CLIP-seq
MIRT786412	hsa-miR-3673	CLIP-seq
MIRT786413	hsa-miR-4484	CLIP-seq
MIRT786414	hsa-miR-455-5p	CLIP-seq
MIRT786415	hsa-miR-4799-5p	CLIP-seq
MIRT786416	hsa-miR-520d-5p	CLIP-seq
MIRT786417	hsa-miR-524-5p	CLIP-seq
MIRT786418	hsa-miR-613	CLIP-seq
MIRT786419	hsa-miR-885-5p	CLIP-seq
MIRT786420	hsa-miR-1252	CLIP-seq
MIRT786421	hsa-miR-3647-3p	CLIP-seq
MIRT786422	hsa-miR-4775	CLIP-seq
MIRT786423	hsa-miR-590-3p	CLIP-seq
MIRT2475342	hsa-miR-1827	CLIP-seq
MIRT2475343	hsa-miR-3609	CLIP-seq
MIRT2475344	hsa-miR-4709-3p	CLIP-seq
MIRT2475345	hsa-miR-548ah	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0001786	Function	Phosphatidylserine binding	IDA	15813707, 27676605
GO:0005509	Function	Calcium ion binding	IDA	27676605
GO:0005509	Function	Calcium ion binding	IEA
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	27676605
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	1530946
GO:0012506	Component	Vesicle membrane	IBA
GO:0016020	Component	Membrane	IDA	27676605
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0030154	Process	Cell differentiation	NAS	1530946
GO:0031210	Function	Phosphatidylcholine binding	IDA	15813707
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042997	Process	Negative regulation of Golgi to plasma membrane protein transport	ISS
GO:0042998	Process	Positive regulation of Golgi to plasma membrane protein transport	ISS
GO:0045121	Component	Membrane raft	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070382	Component	Exocytic vesicle	ISS
GO:1901611	Function	Phosphatidylglycerol binding	IDA	15813707, 27676605

Other IDs

• MIM: 602573
• HGNC: 536
• e!Ensembl: ENSG00000104537

Protein

• UniProt ID: P27216
• Protein name: Annexin A13 (Annexin XIII) (Annexin-13) (Intestine-specific annexin) (ISA)
• Protein function: [Isoform A]: Binds to membranes enriched in phosphatidylserine or phosphatidylglycerol in a calcium-dependent manner (PubMed:27676605, PubMed:30610115). Half-maximal membrane binding requires about 60 uM calcium. Does not bind to membranes that
• PDB: 6B3I
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00191	Annexin	18 → 83	Annexin	Family
  PF00191	Annexin	90 → 155	Annexin	Family
  PF00191	Annexin	173 → 239	Annexin	Family
  PF00191	Annexin	249 → 314	Annexin	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in epithelial cells in colon and jejunum (at protein level). Detected in epithelial cells in jejunum. {ECO:0000269|PubMed:1530946}.
• Sequence:

  MGNRHAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATY
  GKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKE
  IIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD
  AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLV
  RCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVR
  SDTSGDFRKLLVALLH

• Sequence length: 316

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	29137596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26644413	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37464398	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26644413	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28423508		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28423508	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28491063		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	27548676		★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	31600943		★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	31600943		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	34675284	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	26110394	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28423508	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29137596		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18000363, 24509171		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	31600943		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26621839, 27588408, 30104711		★☆☆☆☆ Found in Text Mining only