HLA-DOA (major histocompatibility complex, class II, DO alpha)

Gene

• Entrez ID: 3111
• Gene name: Major histocompatibility complex, class II, DO alpha
• Gene symbol: HLA-DOA
• Synonyms (NCBI Gene): HLA-DNA, HLA-DZA, HLADZ
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with cla

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT491507	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT491505	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT491503	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491504	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491502	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491501	hsa-miR-5194	PAR-CLIP	23592263
MIRT491499	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491500	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT491498	hsa-miR-7704	PAR-CLIP	23592263
MIRT491496	hsa-miR-3915	PAR-CLIP	23592263
MIRT491497	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT448019	hsa-miR-4511	PAR-CLIP	22100165
MIRT448018	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT448017	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT448016	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT448015	hsa-miR-3921	PAR-CLIP	22100165
MIRT448014	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT450608	hsa-miR-130b-5p	PAR-CLIP	22100165
MIRT448012	hsa-miR-4251	PAR-CLIP	22100165
MIRT448013	hsa-miR-4329	PAR-CLIP	22100165
MIRT448011	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT448010	hsa-miR-6859-3p	PAR-CLIP	22100165
MIRT448009	hsa-miR-6846-3p	PAR-CLIP	22100165
MIRT448008	hsa-miR-1253	PAR-CLIP	22100165
MIRT448007	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT448006	hsa-miR-3191-5p	PAR-CLIP	22100165
MIRT448005	hsa-miR-4768-5p	PAR-CLIP	22100165
MIRT448004	hsa-miR-6833-3p	PAR-CLIP	22100165
MIRT448002	hsa-miR-6809-3p	PAR-CLIP	22100165
MIRT448019	hsa-miR-4511	PAR-CLIP	22100165
MIRT448018	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT448017	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT448016	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT448015	hsa-miR-3921	PAR-CLIP	22100165
MIRT448014	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT448012	hsa-miR-4251	PAR-CLIP	22100165
MIRT448013	hsa-miR-4329	PAR-CLIP	22100165
MIRT448011	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT448010	hsa-miR-6859-3p	PAR-CLIP	22100165
MIRT448009	hsa-miR-6846-3p	PAR-CLIP	22100165
MIRT448008	hsa-miR-1253	PAR-CLIP	22100165
MIRT448007	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT448006	hsa-miR-3191-5p	PAR-CLIP	22100165
MIRT448005	hsa-miR-4768-5p	PAR-CLIP	22100165
MIRT448004	hsa-miR-6833-3p	PAR-CLIP	22100165
MIRT448002	hsa-miR-6809-3p	PAR-CLIP	22100165
MIRT491507	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT491505	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT491503	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491504	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491502	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491501	hsa-miR-5194	PAR-CLIP	23592263
MIRT491499	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491500	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT491498	hsa-miR-7704	PAR-CLIP	23592263
MIRT491496	hsa-miR-3915	PAR-CLIP	23592263
MIRT491497	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT448019	hsa-miR-4511	PAR-CLIP	22100165
MIRT448018	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT448017	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT448016	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT448015	hsa-miR-3921	PAR-CLIP	22100165
MIRT448014	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT450608	hsa-miR-130b-5p	PAR-CLIP	22100165
MIRT448012	hsa-miR-4251	PAR-CLIP	22100165
MIRT448013	hsa-miR-4329	PAR-CLIP	22100165
MIRT448011	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT448010	hsa-miR-6859-3p	PAR-CLIP	22100165
MIRT448009	hsa-miR-6846-3p	PAR-CLIP	22100165
MIRT448008	hsa-miR-1253	PAR-CLIP	22100165
MIRT448007	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT448006	hsa-miR-3191-5p	PAR-CLIP	22100165
MIRT448005	hsa-miR-4768-5p	PAR-CLIP	22100165
MIRT448004	hsa-miR-6833-3p	PAR-CLIP	22100165
MIRT448002	hsa-miR-6809-3p	PAR-CLIP	22100165
MIRT448019	hsa-miR-4511	PAR-CLIP	22100165
MIRT448018	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT448017	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT448016	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT448015	hsa-miR-3921	PAR-CLIP	22100165
MIRT448014	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT448012	hsa-miR-4251	PAR-CLIP	22100165
MIRT448013	hsa-miR-4329	PAR-CLIP	22100165
MIRT448011	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT448010	hsa-miR-6859-3p	PAR-CLIP	22100165
MIRT448009	hsa-miR-6846-3p	PAR-CLIP	22100165
MIRT448008	hsa-miR-1253	PAR-CLIP	22100165
MIRT448007	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT448006	hsa-miR-3191-5p	PAR-CLIP	22100165
MIRT448005	hsa-miR-4768-5p	PAR-CLIP	22100165
MIRT448004	hsa-miR-6833-3p	PAR-CLIP	22100165
MIRT448002	hsa-miR-6809-3p	PAR-CLIP	22100165
MIRT1048296	hsa-miR-1202	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT1048298	hsa-miR-1272	CLIP-seq
MIRT1048299	hsa-miR-1273f	CLIP-seq
MIRT1048300	hsa-miR-135a	CLIP-seq
MIRT1048301	hsa-miR-135b	CLIP-seq
MIRT1048302	hsa-miR-143	CLIP-seq
MIRT1048303	hsa-miR-1827	CLIP-seq
MIRT1048304	hsa-miR-1972	CLIP-seq
MIRT1048305	hsa-miR-2114	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT1048307	hsa-miR-3130-3p	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT1048309	hsa-miR-3152-5p	CLIP-seq
MIRT1048310	hsa-miR-3180-5p	CLIP-seq
MIRT1048311	hsa-miR-3194-5p	CLIP-seq
MIRT1048312	hsa-miR-3202	CLIP-seq
MIRT1048313	hsa-miR-325	CLIP-seq
MIRT1048314	hsa-miR-3545-3p	CLIP-seq
MIRT1048315	hsa-miR-3591-5p	CLIP-seq
MIRT1048316	hsa-miR-3614-3p	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT1048318	hsa-miR-3664-3p	CLIP-seq
MIRT1048319	hsa-miR-3667-3p	CLIP-seq
MIRT1048320	hsa-miR-3668	CLIP-seq
MIRT1048321	hsa-miR-3674	CLIP-seq
MIRT1048322	hsa-miR-3689d	CLIP-seq
MIRT1048323	hsa-miR-384	CLIP-seq
MIRT1048324	hsa-miR-3926	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT1048326	hsa-miR-3972	CLIP-seq
MIRT1048327	hsa-miR-4252	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT1048329	hsa-miR-4297	CLIP-seq
MIRT1048330	hsa-miR-4299	CLIP-seq
MIRT1048331	hsa-miR-4324	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048334	hsa-miR-4431	CLIP-seq
MIRT1048335	hsa-miR-4433	CLIP-seq
MIRT1048336	hsa-miR-4446-3p	CLIP-seq
MIRT1048337	hsa-miR-4459	CLIP-seq
MIRT1048338	hsa-miR-4473	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT1048340	hsa-miR-4492	CLIP-seq
MIRT1048341	hsa-miR-4498	CLIP-seq
MIRT1048342	hsa-miR-4505	CLIP-seq
MIRT1048343	hsa-miR-4529-5p	CLIP-seq
MIRT1048344	hsa-miR-4649-3p	CLIP-seq
MIRT1048345	hsa-miR-4671-3p	CLIP-seq
MIRT1048346	hsa-miR-4680-5p	CLIP-seq
MIRT1048347	hsa-miR-4695-5p	CLIP-seq
MIRT1048348	hsa-miR-4708-5p	CLIP-seq
MIRT1048349	hsa-miR-4722-5p	CLIP-seq
MIRT1048350	hsa-miR-4726-3p	CLIP-seq
MIRT1048351	hsa-miR-4732-5p	CLIP-seq
MIRT1048352	hsa-miR-4733-3p	CLIP-seq
MIRT1048353	hsa-miR-4747-5p	CLIP-seq
MIRT1048354	hsa-miR-4768-3p	CLIP-seq
MIRT1048355	hsa-miR-4770	CLIP-seq
MIRT1048356	hsa-miR-4774-3p	CLIP-seq
MIRT1048357	hsa-miR-4786-5p	CLIP-seq
MIRT1048358	hsa-miR-4790-3p	CLIP-seq
MIRT1048359	hsa-miR-4793-5p	CLIP-seq
MIRT1048360	hsa-miR-4797-5p	CLIP-seq
MIRT1048361	hsa-miR-485-5p	CLIP-seq
MIRT1048362	hsa-miR-508-5p	CLIP-seq
MIRT1048363	hsa-miR-510	CLIP-seq
MIRT1048364	hsa-miR-512-3p	CLIP-seq
MIRT1048365	hsa-miR-512-5p	CLIP-seq
MIRT1048366	hsa-miR-520f	CLIP-seq
MIRT1048367	hsa-miR-542-3p	CLIP-seq
MIRT1048368	hsa-miR-548s	CLIP-seq
MIRT1048369	hsa-miR-554	CLIP-seq
MIRT1048370	hsa-miR-561	CLIP-seq
MIRT1048371	hsa-miR-615-5p	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq
MIRT1048373	hsa-miR-665	CLIP-seq
MIRT1048374	hsa-miR-759	CLIP-seq
MIRT1048375	hsa-miR-762	CLIP-seq
MIRT1048376	hsa-miR-766	CLIP-seq
MIRT1048377	hsa-miR-767-5p	CLIP-seq
MIRT1048378	hsa-miR-769-5p	CLIP-seq
MIRT1048379	hsa-miR-940	CLIP-seq
MIRT1549532	hsa-miR-1910	CLIP-seq
MIRT1549533	hsa-miR-4421	CLIP-seq
MIRT1549534	hsa-miR-4757-5p	CLIP-seq
MIRT2010991	hsa-miR-1184	CLIP-seq
MIRT1048299	hsa-miR-1273f	CLIP-seq
MIRT2010992	hsa-miR-1343	CLIP-seq
MIRT2010993	hsa-miR-145	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT2010994	hsa-miR-3122	CLIP-seq
MIRT1048310	hsa-miR-3180-5p	CLIP-seq
MIRT1048314	hsa-miR-3545-3p	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT2010995	hsa-miR-3689a-3p	CLIP-seq
MIRT2010996	hsa-miR-3689c	CLIP-seq
MIRT2010997	hsa-miR-378g	CLIP-seq
MIRT2010998	hsa-miR-3913-5p	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT2010999	hsa-miR-4418	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT2011000	hsa-miR-4437	CLIP-seq
MIRT1048342	hsa-miR-4505	CLIP-seq
MIRT2011001	hsa-miR-4674	CLIP-seq
MIRT1048346	hsa-miR-4680-5p	CLIP-seq
MIRT2011002	hsa-miR-4712-5p	CLIP-seq
MIRT1048353	hsa-miR-4747-5p	CLIP-seq
MIRT2011003	hsa-miR-509-3-5p	CLIP-seq
MIRT2011004	hsa-miR-509-5p	CLIP-seq
MIRT1048368	hsa-miR-548s	CLIP-seq
MIRT2011005	hsa-miR-770-5p	CLIP-seq
MIRT2010991	hsa-miR-1184	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT2243257	hsa-miR-1228	CLIP-seq
MIRT1048299	hsa-miR-1273f	CLIP-seq
MIRT2010992	hsa-miR-1343	CLIP-seq
MIRT1048300	hsa-miR-135a	CLIP-seq
MIRT1048301	hsa-miR-135b	CLIP-seq
MIRT2243258	hsa-miR-142-3p	CLIP-seq
MIRT1048302	hsa-miR-143	CLIP-seq
MIRT2010993	hsa-miR-145	CLIP-seq
MIRT1048303	hsa-miR-1827	CLIP-seq
MIRT1048305	hsa-miR-2114	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT2243259	hsa-miR-296-3p	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT2243260	hsa-miR-3160-3p	CLIP-seq
MIRT1048314	hsa-miR-3545-3p	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT1048318	hsa-miR-3664-3p	CLIP-seq
MIRT2243261	hsa-miR-3664-5p	CLIP-seq
MIRT2243262	hsa-miR-3677-5p	CLIP-seq
MIRT2243263	hsa-miR-3682-3p	CLIP-seq
MIRT2010995	hsa-miR-3689a-3p	CLIP-seq
MIRT2010996	hsa-miR-3689c	CLIP-seq
MIRT1048322	hsa-miR-3689d	CLIP-seq
MIRT2010997	hsa-miR-378g	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT2243264	hsa-miR-4280	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT2010999	hsa-miR-4418	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048335	hsa-miR-4433	CLIP-seq
MIRT2011000	hsa-miR-4437	CLIP-seq
MIRT1048337	hsa-miR-4459	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT2243265	hsa-miR-4487	CLIP-seq
MIRT2243266	hsa-miR-4639-3p	CLIP-seq
MIRT1048344	hsa-miR-4649-3p	CLIP-seq
MIRT2243267	hsa-miR-4652-3p	CLIP-seq
MIRT2011001	hsa-miR-4674	CLIP-seq
MIRT1048346	hsa-miR-4680-5p	CLIP-seq
MIRT1048347	hsa-miR-4695-5p	CLIP-seq
MIRT1048348	hsa-miR-4708-5p	CLIP-seq
MIRT2011002	hsa-miR-4712-5p	CLIP-seq
MIRT1048349	hsa-miR-4722-5p	CLIP-seq
MIRT2243268	hsa-miR-4728-5p	CLIP-seq
MIRT1048354	hsa-miR-4768-3p	CLIP-seq
MIRT1048355	hsa-miR-4770	CLIP-seq
MIRT1048361	hsa-miR-485-5p	CLIP-seq
MIRT2011003	hsa-miR-509-3-5p	CLIP-seq
MIRT2011004	hsa-miR-509-5p	CLIP-seq
MIRT1048363	hsa-miR-510	CLIP-seq
MIRT1048365	hsa-miR-512-5p	CLIP-seq
MIRT2243269	hsa-miR-558	CLIP-seq
MIRT2243270	hsa-miR-598	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq
MIRT2011005	hsa-miR-770-5p	CLIP-seq
MIRT2243271	hsa-miR-935	CLIP-seq
MIRT1048379	hsa-miR-940	CLIP-seq
MIRT2010991	hsa-miR-1184	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT1048310	hsa-miR-3180-5p	CLIP-seq
MIRT1048314	hsa-miR-3545-3p	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT2010999	hsa-miR-4418	CLIP-seq
MIRT1048346	hsa-miR-4680-5p	CLIP-seq
MIRT2011003	hsa-miR-509-3-5p	CLIP-seq
MIRT2011004	hsa-miR-509-5p	CLIP-seq
MIRT2451234	hsa-miR-1182	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT2243261	hsa-miR-3664-5p	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT2243266	hsa-miR-4639-3p	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT1048298	hsa-miR-1272	CLIP-seq
MIRT2546435	hsa-miR-2277-3p	CLIP-seq
MIRT1048306	hsa-miR-24	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT2546436	hsa-miR-3662	CLIP-seq
MIRT1048324	hsa-miR-3926	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT1048328	hsa-miR-4284	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT1048343	hsa-miR-4529-5p	CLIP-seq
MIRT2546437	hsa-miR-4638-5p	CLIP-seq
MIRT2546438	hsa-miR-4684-5p	CLIP-seq
MIRT1048359	hsa-miR-4793-5p	CLIP-seq
MIRT2546439	hsa-miR-548c-3p	CLIP-seq
MIRT1048368	hsa-miR-548s	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq
MIRT1048297	hsa-miR-122	CLIP-seq
MIRT1048298	hsa-miR-1272	CLIP-seq
MIRT2546435	hsa-miR-2277-3p	CLIP-seq
MIRT1048308	hsa-miR-3135b	CLIP-seq
MIRT1048317	hsa-miR-3652	CLIP-seq
MIRT2546436	hsa-miR-3662	CLIP-seq
MIRT1048325	hsa-miR-3929	CLIP-seq
MIRT1048332	hsa-miR-4419b	CLIP-seq
MIRT1048333	hsa-miR-4430	CLIP-seq
MIRT1048339	hsa-miR-4478	CLIP-seq
MIRT2546437	hsa-miR-4638-5p	CLIP-seq
MIRT2546438	hsa-miR-4684-5p	CLIP-seq
MIRT2546439	hsa-miR-548c-3p	CLIP-seq
MIRT1048372	hsa-miR-645	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Activation	11823510
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0002587	Process	Negative regulation of antigen processing and presentation of peptide antigen via MHC class II	IDA	22733780
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	TAS	3000765
GO:0006955	Process	Immune response	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0023026	Function	MHC class II protein complex binding	IDA	22733780
GO:0031902	Component	Late endosome membrane	IBA
GO:0032395	Function	MHC class II receptor activity	TAS	3000765
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IDA	22733780
GO:0042613	Component	MHC class II protein complex	IEA
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA

Other IDs

• MIM: 142930
• HGNC: 4936
• e!Ensembl: ENSG00000204252

Protein

• UniProt ID: P06340
• Protein name: HLA class II histocompatibility antigen, DO alpha chain (MHC DN-alpha) (MHC DZ alpha) (MHC class II antigen DOA)
• Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B-cells. Modifies peptide exchange activity of HLA-DM.
• PDB: 4I0P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00993	MHC_II_alpha	29 → 109	Class II histocompatibility antigen, alpha domain	Domain
  PF07654	C1-set	115 → 196	Immunoglobulin C1-set domain	Domain

• Sequence:

  MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSV
  DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK
  SRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV
  PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
  MGTYVSSVPR

• Sequence length: 250

Pathways

KEGG:

Phagosome
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Reactome:

MHC class II antigen presentation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC INTERSTITIAL CYSTITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Addison Disease	Addison`s Disease	BEFREE	15240634, 9398726		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	27210825		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	31580408		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	28705838		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	2902225		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	12917841		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27600773		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12114354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	21716163		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	12873588, 23551963, 31298041		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	12439622		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15592805, 16189655, 20138855, 28532625, 3014346		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23829277, 31580408		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11205913, 24014088		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	23900675, 27644617		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15218356, 16527605, 27304060, 28097051, 29118259		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	12114354		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11205913, 24014088		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29033936		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19117353		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	7879822		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	19107404, 24201079		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19107404, 24201079		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19245431		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1339304		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29970719		★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	6318983		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	3017844		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	29660300		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	20626023		★☆☆☆☆ Found in Text Mining only
CTLA4 Haploinsufficiency	CTLA4 deficiency	BEFREE	30377434		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16461143, 29660300		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11894970, 19949652, 20610662, 22218756, 23261825, 24465825, 25185645, 2801776, 3417056		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11886709		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	25185645		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	16121403		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	27671914		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16461143, 29660300		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	7779117		★☆☆☆☆ Found in Text Mining only
Erythrokeratoderma	Erythrokeratoderma	BEFREE	20854438		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31424306		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31424306		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	22905924, 23480667		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	8488546		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10369864, 12097196, 14570752, 18059468, 22218756		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	19240270		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	14570752		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31580408		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	7997453, 92196		★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	92196		★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	29660300		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	21034161, 30319055		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27965521		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	16206510, 19332045		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1709379		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16908353		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19778566, 30539855		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16735466, 27894401, 28463775		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	27644617		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15218356, 16527605, 27304060, 28097051, 29118259		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31424306		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29033936		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19117353		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22011251		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15695002, 16541432		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11205913, 24014088		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12439622, 18757416, 19638588, 20920330, 21387262, 23656731, 23701182, 23745791, 24307627, 24493286, 24934372, 27498821, 28532625, 29033936, 29980467, 30873379, 31068932, 31555274		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19107404, 24201079		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23709751, 27628745, 29118259, 29707161		★☆☆☆☆ Found in Text Mining only
Meleda Disease	Meleda Disease	BEFREE	20854438		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	25207460, 25922203, 27590328, 29033936, 29948466, 30488824		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20626023		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14616291, 18256983, 23039885, 72803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	BEFREE	22218756		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	9523228		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19922464		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14616291, 18629495, 19107404, 19752747, 24728075, 28084572, 28705838, 29118259, 29682176		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	27424137		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29100337, 30612418		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21453059, 21612409, 25000484, 25230787		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19117353		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22011251		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	27210825		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	1420116		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	20557968, 22118691, 23432218, 28642883		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	1420116		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26013045, 8178173		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	29850619		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15546339, 19741715, 27486778, 2898314		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088, 21156761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	15881277		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	11261326		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27354668		★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	25922203		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15695002, 16541432		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16189655		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31580408		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	9951811		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25615025		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19089435		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	10215771, 26013045		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	10215771, 26013045		★☆☆☆☆ Found in Text Mining only