Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3107
Gene name	Major histocompatibility complex, class I, C
Gene symbol	HLA-C
Synonyms (NCBI Gene)	D6S204HLA-JY3HLACHLC-CMHCPSORS1
Chromosome	6
Chromosome location	6p21.33
Summary	HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the

243

Show/Hide all (243)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051644	hsa-let-7e-5p	CLASH	23622248
MIRT042611	hsa-miR-423-3p	CLASH	23622248
MIRT041720	hsa-miR-484	CLASH	23622248
MIRT487939	hsa-miR-6854-5p	PAR-CLIP	23592263
MIRT487938	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT487937	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT487936	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT487935	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT487934	hsa-miR-767-5p	PAR-CLIP	23592263
MIRT487933	hsa-miR-4660	PAR-CLIP	23592263
MIRT487931	hsa-miR-3672	PAR-CLIP	23592263
MIRT487932	hsa-miR-6864-3p	PAR-CLIP	23592263
MIRT487938	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT487937	hsa-miR-148b-3p	PAR-CLIP	26701625
MIRT487936	hsa-miR-152-3p	PAR-CLIP	26701625
MIRT487931	hsa-miR-3672	PAR-CLIP	26701625
MIRT487935	hsa-miR-4524a-3p	PAR-CLIP	26701625
MIRT487933	hsa-miR-4660	PAR-CLIP	26701625
MIRT487939	hsa-miR-6854-5p	PAR-CLIP	26701625
MIRT487932	hsa-miR-6864-3p	PAR-CLIP	26701625
MIRT487934	hsa-miR-767-5p	PAR-CLIP	26701625
MIRT487938	hsa-miR-148a-3p	RNA-seqqRT-PCR	31578687
MIRT487939	hsa-miR-6854-5p	PAR-CLIP	23592263
MIRT487938	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT487937	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT487936	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT487935	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT487934	hsa-miR-767-5p	PAR-CLIP	23592263
MIRT487933	hsa-miR-4660	PAR-CLIP	23592263
MIRT487931	hsa-miR-3672	PAR-CLIP	23592263
MIRT487932	hsa-miR-6864-3p	PAR-CLIP	23592263
MIRT1048289	hsa-miR-1224-3p	CLIP-seq
MIRT1048290	hsa-miR-3138	CLIP-seq
MIRT1048291	hsa-miR-3151	CLIP-seq
MIRT1048292	hsa-miR-3191	CLIP-seq
MIRT1048293	hsa-miR-4323	CLIP-seq
MIRT1048294	hsa-miR-4462	CLIP-seq
MIRT1048295	hsa-miR-4758-3p	CLIP-seq
MIRT1549529	hsa-miR-3166	CLIP-seq
MIRT1549530	hsa-miR-4311	CLIP-seq
MIRT1549531	hsa-miR-4708-5p	CLIP-seq
MIRT1556533	hsa-miR-23a	CLIP-seq
MIRT1556534	hsa-miR-23b	CLIP-seq
MIRT1556535	hsa-miR-23c	CLIP-seq
MIRT1556536	hsa-miR-3146	CLIP-seq
MIRT1048289	hsa-miR-1224-3p	CLIP-seq
MIRT2010979	hsa-miR-181a	CLIP-seq
MIRT2010980	hsa-miR-181b	CLIP-seq
MIRT2010981	hsa-miR-181c	CLIP-seq
MIRT2010982	hsa-miR-181d	CLIP-seq
MIRT2010983	hsa-miR-2467-5p	CLIP-seq
MIRT2010984	hsa-miR-4262	CLIP-seq
MIRT1549530	hsa-miR-4311	CLIP-seq
MIRT1549531	hsa-miR-4708-5p	CLIP-seq
MIRT2010985	hsa-miR-593	CLIP-seq
MIRT2010986	hsa-miR-626	CLIP-seq
MIRT2010987	hsa-miR-642b	CLIP-seq
MIRT2243221	hsa-miR-103b	CLIP-seq
MIRT2243222	hsa-miR-1301	CLIP-seq
MIRT2243223	hsa-miR-146a	CLIP-seq
MIRT2243224	hsa-miR-146b-5p	CLIP-seq
MIRT2243225	hsa-miR-148a	CLIP-seq
MIRT2243226	hsa-miR-148b	CLIP-seq
MIRT2243227	hsa-miR-152	CLIP-seq
MIRT2243228	hsa-miR-1587	CLIP-seq
MIRT2243229	hsa-miR-224	CLIP-seq
MIRT2010983	hsa-miR-2467-5p	CLIP-seq
MIRT1048290	hsa-miR-3138	CLIP-seq
MIRT1048291	hsa-miR-3151	CLIP-seq
MIRT2243230	hsa-miR-3162-5p	CLIP-seq
MIRT1048292	hsa-miR-3191	CLIP-seq
MIRT2243231	hsa-miR-3616-5p	CLIP-seq
MIRT2243232	hsa-miR-3647-5p	CLIP-seq
MIRT2243233	hsa-miR-3653	CLIP-seq
MIRT2243234	hsa-miR-376a	CLIP-seq
MIRT2243235	hsa-miR-376b	CLIP-seq
MIRT2243236	hsa-miR-4417	CLIP-seq
MIRT2243237	hsa-miR-4428	CLIP-seq
MIRT1048294	hsa-miR-4462	CLIP-seq
MIRT2243238	hsa-miR-4492	CLIP-seq
MIRT2243239	hsa-miR-4498	CLIP-seq
MIRT2243240	hsa-miR-4635	CLIP-seq
MIRT2243241	hsa-miR-4651	CLIP-seq
MIRT2243242	hsa-miR-4656	CLIP-seq
MIRT2243243	hsa-miR-4675	CLIP-seq
MIRT2243244	hsa-miR-4719	CLIP-seq
MIRT2243245	hsa-miR-4741	CLIP-seq
MIRT2243246	hsa-miR-4787-5p	CLIP-seq
MIRT2243247	hsa-miR-5047	CLIP-seq
MIRT2243248	hsa-miR-541	CLIP-seq
MIRT2243249	hsa-miR-548p	CLIP-seq
MIRT2243250	hsa-miR-573	CLIP-seq
MIRT2243251	hsa-miR-580	CLIP-seq
MIRT2243252	hsa-miR-589	CLIP-seq
MIRT2243253	hsa-miR-602	CLIP-seq
MIRT2243254	hsa-miR-608	CLIP-seq
MIRT2243255	hsa-miR-654-5p	CLIP-seq
MIRT2243256	hsa-miR-762	CLIP-seq
MIRT1556533	hsa-miR-23a	CLIP-seq
MIRT1556534	hsa-miR-23b	CLIP-seq
MIRT1556535	hsa-miR-23c	CLIP-seq
MIRT2010983	hsa-miR-2467-5p	CLIP-seq
MIRT1556536	hsa-miR-3146	CLIP-seq
MIRT1048291	hsa-miR-3151	CLIP-seq
MIRT1549529	hsa-miR-3166	CLIP-seq
MIRT2389011	hsa-miR-3185	CLIP-seq
MIRT1048292	hsa-miR-3191	CLIP-seq
MIRT2389012	hsa-miR-3611	CLIP-seq
MIRT2243231	hsa-miR-3616-5p	CLIP-seq
MIRT2243232	hsa-miR-3647-5p	CLIP-seq
MIRT1549530	hsa-miR-4311	CLIP-seq
MIRT2243240	hsa-miR-4635	CLIP-seq
MIRT1549531	hsa-miR-4708-5p	CLIP-seq
MIRT2243250	hsa-miR-573	CLIP-seq
MIRT2010987	hsa-miR-642b	CLIP-seq
MIRT2429616	hsa-miR-125a-3p	CLIP-seq
MIRT2010979	hsa-miR-181a	CLIP-seq
MIRT2010980	hsa-miR-181b	CLIP-seq
MIRT2010981	hsa-miR-181c	CLIP-seq
MIRT2010982	hsa-miR-181d	CLIP-seq
MIRT2429617	hsa-miR-298	CLIP-seq
MIRT2429618	hsa-miR-3121-5p	CLIP-seq
MIRT1048290	hsa-miR-3138	CLIP-seq
MIRT1048291	hsa-miR-3151	CLIP-seq
MIRT1048292	hsa-miR-3191	CLIP-seq
MIRT2429619	hsa-miR-3678-3p	CLIP-seq
MIRT2429620	hsa-miR-3934	CLIP-seq
MIRT2010984	hsa-miR-4262	CLIP-seq
MIRT1048294	hsa-miR-4462	CLIP-seq
MIRT2243241	hsa-miR-4651	CLIP-seq
MIRT2243246	hsa-miR-4787-5p	CLIP-seq
MIRT2243253	hsa-miR-602	CLIP-seq
MIRT2243254	hsa-miR-608	CLIP-seq
MIRT2010987	hsa-miR-642b	CLIP-seq
MIRT2429621	hsa-miR-764	CLIP-seq
MIRT2435125	hsa-miR-873	CLIP-seq
MIRT2429616	hsa-miR-125a-3p	CLIP-seq
MIRT2243228	hsa-miR-1587	CLIP-seq
MIRT2010979	hsa-miR-181a	CLIP-seq
MIRT2010980	hsa-miR-181b	CLIP-seq
MIRT2010981	hsa-miR-181c	CLIP-seq
MIRT2010982	hsa-miR-181d	CLIP-seq
MIRT1556533	hsa-miR-23a	CLIP-seq
MIRT1556534	hsa-miR-23b	CLIP-seq
MIRT1556535	hsa-miR-23c	CLIP-seq
MIRT2429617	hsa-miR-298	CLIP-seq
MIRT2429618	hsa-miR-3121-5p	CLIP-seq
MIRT1048290	hsa-miR-3138	CLIP-seq
MIRT1556536	hsa-miR-3146	CLIP-seq
MIRT1048291	hsa-miR-3151	CLIP-seq
MIRT1549529	hsa-miR-3166	CLIP-seq
MIRT1048292	hsa-miR-3191	CLIP-seq
MIRT2429619	hsa-miR-3678-3p	CLIP-seq
MIRT2429620	hsa-miR-3934	CLIP-seq
MIRT2010984	hsa-miR-4262	CLIP-seq
MIRT1549530	hsa-miR-4311	CLIP-seq
MIRT2243236	hsa-miR-4417	CLIP-seq
MIRT1048294	hsa-miR-4462	CLIP-seq
MIRT2243238	hsa-miR-4492	CLIP-seq
MIRT2243239	hsa-miR-4498	CLIP-seq
MIRT2243241	hsa-miR-4651	CLIP-seq
MIRT2243242	hsa-miR-4656	CLIP-seq
MIRT2243243	hsa-miR-4675	CLIP-seq
MIRT1549531	hsa-miR-4708-5p	CLIP-seq
MIRT2243245	hsa-miR-4741	CLIP-seq
MIRT2243246	hsa-miR-4787-5p	CLIP-seq
MIRT2243248	hsa-miR-541	CLIP-seq
MIRT2010985	hsa-miR-593	CLIP-seq
MIRT2243253	hsa-miR-602	CLIP-seq
MIRT2243254	hsa-miR-608	CLIP-seq
MIRT2010986	hsa-miR-626	CLIP-seq
MIRT2010987	hsa-miR-642b	CLIP-seq
MIRT2243255	hsa-miR-654-5p	CLIP-seq
MIRT2243256	hsa-miR-762	CLIP-seq
MIRT2429621	hsa-miR-764	CLIP-seq
MIRT2435125	hsa-miR-873	CLIP-seq
MIRT2429616	hsa-miR-125a-3p	CLIP-seq
MIRT2243228	hsa-miR-1587	CLIP-seq
MIRT2010979	hsa-miR-181a	CLIP-seq
MIRT2010980	hsa-miR-181b	CLIP-seq
MIRT2010981	hsa-miR-181c	CLIP-seq
MIRT2010982	hsa-miR-181d	CLIP-seq
MIRT1556533	hsa-miR-23a	CLIP-seq
MIRT1556534	hsa-miR-23b	CLIP-seq
MIRT1556535	hsa-miR-23c	CLIP-seq
MIRT2010983	hsa-miR-2467-5p	CLIP-seq
MIRT2429617	hsa-miR-298	CLIP-seq
MIRT2429618	hsa-miR-3121-5p	CLIP-seq
MIRT1556536	hsa-miR-3146	CLIP-seq
MIRT1549529	hsa-miR-3166	CLIP-seq
MIRT2429619	hsa-miR-3678-3p	CLIP-seq
MIRT2429620	hsa-miR-3934	CLIP-seq
MIRT2010984	hsa-miR-4262	CLIP-seq
MIRT1549530	hsa-miR-4311	CLIP-seq
MIRT2243236	hsa-miR-4417	CLIP-seq
MIRT1048294	hsa-miR-4462	CLIP-seq
MIRT2243238	hsa-miR-4492	CLIP-seq
MIRT2243239	hsa-miR-4498	CLIP-seq
MIRT2243241	hsa-miR-4651	CLIP-seq
MIRT2243242	hsa-miR-4656	CLIP-seq
MIRT2243243	hsa-miR-4675	CLIP-seq
MIRT1549531	hsa-miR-4708-5p	CLIP-seq
MIRT2243245	hsa-miR-4741	CLIP-seq
MIRT2243246	hsa-miR-4787-5p	CLIP-seq
MIRT2243248	hsa-miR-541	CLIP-seq
MIRT2010985	hsa-miR-593	CLIP-seq
MIRT2243253	hsa-miR-602	CLIP-seq
MIRT2243254	hsa-miR-608	CLIP-seq
MIRT2010986	hsa-miR-626	CLIP-seq
MIRT2010987	hsa-miR-642b	CLIP-seq
MIRT2243255	hsa-miR-654-5p	CLIP-seq
MIRT2243256	hsa-miR-762	CLIP-seq
MIRT2429621	hsa-miR-764	CLIP-seq
MIRT1048289	hsa-miR-1224-3p	CLIP-seq
MIRT2429616	hsa-miR-125a-3p	CLIP-seq
MIRT2243228	hsa-miR-1587	CLIP-seq
MIRT2010979	hsa-miR-181a	CLIP-seq
MIRT2010980	hsa-miR-181b	CLIP-seq
MIRT2010981	hsa-miR-181c	CLIP-seq
MIRT2010982	hsa-miR-181d	CLIP-seq
MIRT2429617	hsa-miR-298	CLIP-seq
MIRT2429618	hsa-miR-3121-5p	CLIP-seq
MIRT2429619	hsa-miR-3678-3p	CLIP-seq
MIRT2429620	hsa-miR-3934	CLIP-seq
MIRT2010984	hsa-miR-4262	CLIP-seq
MIRT1549530	hsa-miR-4311	CLIP-seq
MIRT2243236	hsa-miR-4417	CLIP-seq
MIRT2243238	hsa-miR-4492	CLIP-seq
MIRT2243239	hsa-miR-4498	CLIP-seq
MIRT2243241	hsa-miR-4651	CLIP-seq
MIRT2243242	hsa-miR-4656	CLIP-seq
MIRT2243243	hsa-miR-4675	CLIP-seq
MIRT1549531	hsa-miR-4708-5p	CLIP-seq
MIRT2243245	hsa-miR-4741	CLIP-seq
MIRT2243246	hsa-miR-4787-5p	CLIP-seq
MIRT2243248	hsa-miR-541	CLIP-seq
MIRT2010985	hsa-miR-593	CLIP-seq
MIRT2243254	hsa-miR-608	CLIP-seq
MIRT2010986	hsa-miR-626	CLIP-seq
MIRT2010987	hsa-miR-642b	CLIP-seq
MIRT2243255	hsa-miR-654-5p	CLIP-seq
MIRT2243256	hsa-miR-762	CLIP-seq
MIRT2429621	hsa-miR-764	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
CIITA	Activation	11053628
HIVEP2	Unknown	1409593
MYC	Activation	8206526
MYCN	Unknown	8895520

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002474	Process	Antigen processing and presentation of peptide antigen via MHC class I	IEA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IDA	22031944
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	12853576, 17056715, 18322206, 18624290, 19858347, 24018270, 27649529, 28546555, 28685972
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12486241
GO:0005783	Component	Endoplasmic reticulum	IDA	20946353
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	20946353
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	1384166, 2708822, 2787363, 2843461
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	1384166, 2708822, 2787363, 2843461
GO:0007165	Process	Signal transduction	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	9754572, 22031944
GO:0009986	Component	Cell surface	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	IDA	22031944
GO:0042612	Component	MHC class I protein complex	IDA	22031944
GO:0042612	Component	MHC class I protein complex	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	12486241
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	12486241
GO:0046977	Function	TAP binding	IDA	8617941, 8805302
GO:0048018	Function	Receptor ligand activity	IDA	12486241
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055038	Component	Recycling endosome membrane	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IEA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS

MIM	HGNC	e!Ensembl
142840	4933	ENSG00000204525

P10321

Protein name

HLA class I histocompatibility antigen, C alpha chain (HLA-C) (HLA-Cw) (Human leukocyte antigen C)

Protein function

Antigen-presenting major histocompatibility complex class I (MHCI) molecule with an important role in reproduction and antiviral immunity (PubMed:11172028, PubMed:20104487, PubMed:20439706, PubMed:20972337, PubMed:24091323, PubMed:28649982, PubM

PDB

1EFX , 1IM9 , 1QQD , 3BZF , 4NT6 , 5VGD , 5VGE , 5W67 , 5W69 , 5W6A , 6JTO , 6PA1 , 6PAG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00129	MHC_I	25 → 203	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain
PF07654	C1-set	211 → 290	Immunoglobulin C1-set domain	Domain
PF06623	MHC_I_C	338 → 365	MHC_I C-terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in fetal extravillous trophoblasts in the decidua basalis (at protein level). {ECO:0000269|PubMed:20972337}.

Sequence

MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQ
RMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL
RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP
SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES
LITCKA

Sequence length

366

Interactions

View interactions

	KEGG		Reactome
	Endocytosis Phagosome Cellular senescence Cell adhesion molecules Antigen processing and presentation Natural killer cell mediated cytotoxicity Type I diabetes mellitus Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Viral carcinogenesis Autoimmune thyroid disease Allograft rejection Graft-versus-host disease Viral myocarditis		ER-Phagosome pathway Endosomal/Vacuolar pathway Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell DAP12 interactions Neutrophil degranulation Interferon gamma signaling Interferon alpha/beta signaling Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (52)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-LYMPHOBLASTIC LEUKEMIA/LYMPHOMA WITH T	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC INTERSTITIAL CYSTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B, CHRONIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIV-1 VIREMIA, SUSCEPTIBILITY TO	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SINUSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (275)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	25860853	★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH Deficiency, Isolated	ACTH Deficiency	BEFREE	31468541	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	6150234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26456260, 9753057	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31598144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	29885883	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	2820223	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26456260	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	19081173	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	20819442	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	18515573, 28343170, 30009537	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	12941076	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	28881103	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	23588886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	23588886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	11297692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	10717805, 11231900, 15248224, 18297378, 19912639, 20652381, 20865034, 23083754, 23291587, 23916068, 26321090, 26590821, 26613595, 27522479, 28063628 View all (6 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14517846, 27585683, 29932463	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16313304, 27303036	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	10321964, 10323458, 12011375, 12022360, 12218090, 12610809, 12730526, 12879366, 15513680, 15708881, 16313304, 17166285, 17223660, 17388919, 17530646 View all (28 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	12011375	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	CTD_human_DG	20953186	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	18560587	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	14517846, 27585683, 29932463	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	10750581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21084121, 28627421	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	7858109, 9328330	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10450514, 10468609, 10940893, 11290778, 11526390, 11861076, 11884478, 12392510, 1281639, 15051763, 15342014, 19896815, 20549830, 20652381, 21469129 View all (16 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	16368509, 19254781	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome	Bare Lymphocyte Syndrome	BEFREE	10395672, 10725724, 7749985, 8558015	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bare lymphocyte syndrome 2	Bare Lymphocyte Syndrome	BEFREE	10395672, 10725724, 16573555, 7749985, 8558015	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18627572, 21059670, 23291587, 24821759, 26002027, 26526644, 30425713, 8872174, 9459512, 9509902	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24888570, 26160200	★★★★★ ★☆☆☆☆ Found in Text Mining only
Birdshot chorioretinopathy	Birdshot Chorioretinopathy	BEFREE	30425713	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	20483367	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30720218	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19254781, 21229277, 27631728, 28924054, 29339738	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	BEFREE	16254274, 3512189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	29386826	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	ORPHANET_DG	25163702	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16142345, 19242058, 8414499	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	20519358, 26744525	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30970615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	11053636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27696308, 28130335	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	10567705, 8425289, 8614836	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	9717050	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	11281212, 15342014, 25329633, 8138422	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15893697	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14716759, 15893697	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	11053636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	25163702, 26456260	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	6954127	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	29324974	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	26161794	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	18671674	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15897556	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16003753, 18630461, 26383988	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16003753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	BEFREE	2463126	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	25860853, 25926555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24354957, 25802187, 26769676, 26945896, 29045069	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16141380, 18362229, 22007848, 28453725, 29272013, 31052504, 31270306, 9410910	★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	22772436	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15016654, 17145892, 18698046, 8409397	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22319020	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	19789864, 20036705, 21699788, 23559252, 24248364, 25373727, 26542067, 26891255	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	16365741, 23370861	★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	30298049	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	3718071	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30680818	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	11321249, 11454986, 12956875, 22125590	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	20819442	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10430937, 19289270, 21909837, 8370480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10430937, 19289270, 21909837, 8370480	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11960310, 15342014, 15784469, 16568259, 19046302, 19289270, 20580654, 21469129, 21909837, 22069276, 23911738, 25329633, 25831495, 26031759, 28831005 View all (9 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	19205800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	14716759	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16543468, 19081173, 30936220	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	19629158	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	22509813	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29941324	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	17008885, 30680818	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	BEFREE	8272443	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25724317	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30970615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	10084692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	29885883	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31393374	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	25471439	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28427234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	2396258	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	12648227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23526983, 30524896	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19774073, 23526983, 30524896	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11477137, 11519856, 22205738, 28412740, 31591480, 8823750	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	14511464	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria, Renal	Glycosuria, Renal	BEFREE	6524599	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	10382959, 17312133, 18223170, 19812210, 21660940, 22077388, 25519752, 29335631, 29751114, 31586477, 31846439, 9780337	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	17597093, 24908204, 31202168, 8088306, 8096501	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	16368509, 19254781, 27042744, 31199456	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31417179	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	28891951	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	7796500	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16141380, 18362229, 22007848, 28453725, 29272013, 31052504, 31270306, 9410910	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10725870, 28510343, 29546777	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	18053083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	10841946	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28453725	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28453725	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	18362229, 8281665, 8614836	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16078323	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	8096501	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	10525522, 10725281, 10996847, 15550524, 1638703, 24963656, 4076206, 7796500, 7883988, 8343162, 8514894, 8825881, 9742054, 9822100	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	10525522, 8514894	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31736784	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	11709612, 16267409, 21191666, 27522114	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	27852637, 31566423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30703554	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	8894433	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16573555, 21423672, 22013062, 28505602, 30948792, 7749985	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	11004120, 28794251	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23291587, 28651467	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	20857097	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iridocyclitis	Iridocyclitis	BEFREE	9058666	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28824719	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	11717195, 9058666	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11297692, 24278019, 26268853, 30713808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31361395	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	12081993, 22007848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	22031078	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16133450, 19422666, 20729331, 24043749, 26416275, 28751893, 9780337	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15731175, 24748496, 26456260, 28111167, 29358179, 29549293	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14716821, 21998681, 22015712, 7545853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18671674	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	9449717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	9449717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10940893, 11704803, 22587389, 25581336, 26960450, 27781323, 7614783, 9449717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	10940893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	9449717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16044583, 21753148	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	19139084	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	14511464	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31417179	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19254781, 21229277, 27631728, 28924054, 29339738	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	2396258	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25198660	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12664058	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16541432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	20519358, 22140550	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11399124, 11861076, 11894998, 12195346, 12928363, 15016654, 15184663, 15800656, 15893697, 16267409, 16709854, 21753148, 22140550, 22333588, 22386748 View all (26 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15893697	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15897556	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	18336911, 9118943	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10754339, 11207317, 11459172, 15016654, 15608253, 15735047, 16365741, 1668534, 19089914, 20549830, 22219178, 23370861, 25645385, 25795007, 26822383 View all (6 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16365741	★★★★★ ★☆☆☆☆ Found in Text Mining only
MELORHEOSTOSIS, ISOLATED	Melorheostosis	BEFREE	15016654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	12542204, 21625020	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	8272443	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	12673681	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	18263639, 21159685, 25827646, 28501365, 29205643, 9501290	★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	14511464	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30995352	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	18064508	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	25809546, 31122742	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	16490887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10610182, 19907433, 20678810, 20713950, 21067287, 21441263, 21469129, 21496400, 22586495, 29078267, 9345390	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16459714	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	20819442	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	1822352	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	10527401	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	19629158	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15731175	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	14504099, 20079939	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22923051	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29769311	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	14739160	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	17241784, 20819442, 25894229	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	16267409, 20819442, 21191666	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	31171504	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nail Diseases	Nail Diseases	BEFREE	26526644	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	BEFREE	30783092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16219173, 16284396, 30378292, 8738471	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10084692, 10213231, 10856797, 11399124, 11894998, 12109140, 12195346, 12386831, 12902485, 12928363, 1445813, 14716759, 14716821, 15069585, 15608253 View all (67 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	22510877	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	6588753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14504825, 23071666, 2459235, 26202659, 30213788, 30352674, 8852654, 8895520	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	30298049	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30298049	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31393374	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22836042, 30390416, 31598144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24888570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	31002754	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30870043	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	22471616	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23029049, 25198660	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19242058, 24308748	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28407015, 30128145	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23076633	★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	24372652, 26161794	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	12604316	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	18070207	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	18070207, 23330836, 7761479	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	BEFREE	11122018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	11797101, 12011375, 21388355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	29789880	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	20819442, 28794251	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31310798	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	ORPHANET_DG	25163702	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	3718071	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	8717517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	11313318, 25521205, 9731555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12664058	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Protanomaly	Protanomaly	BEFREE	30809016	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	21931540, 23628398, 30932338	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	HPO_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10321964, 10332047, 10469328, 10651991, 10773694, 10801386, 10844560, 10888604, 11069619, 11134234, 11169245, 11348465, 11454986, 11556968, 11875053 View all (161 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	11875053, 12472658, 15191522, 15848982, 15943912, 16642438, 18585007, 19169253, 19169254	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	19169254, 20953190	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	10090613, 10417524, 10545595, 10599883, 10777095, 12115024, 12505198, 12648227, 12730526, 12823445, 15191522, 15214895, 15245541, 15523160, 15654960 View all (19 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	24888570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16078323	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	12648227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	19169254, 20953190	★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	16947780	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	9127144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15016654, 17145892, 18698046, 8409397, 9127144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	22174898	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	24033735	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11960310, 16641046, 16947780, 20179740, 20644721, 20865034, 21373785, 23901134, 24566686, 25672758, 26879349, 27251940, 29361739, 30996811, 8122122, 8323378 View all (1 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18309376	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	21156761	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	LHGDN	18782112	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	25261574	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	18369459, 21388355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15713215	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	GWASDB_DG	22952805	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	22187495, 22433715, 22883433, 24365204, 24888570, 26160200, 29574260, 8272443	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22883433, 24365204	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	18385790, 23362284, 25918017, 26086150, 26928377, 28062682, 28278336, 28438823, 29162886, 29706602, 29762688, 30705045	★★★★★ ★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	1791882	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10395672, 10725724	★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	18636106, 22491464, 30043201, 30878187	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	16866882	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17008885, 22113476, 30967262	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	LHGDN	17652849	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	20483367	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	26526644, 30809016, 31068685	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20519358, 22524849, 25083782	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	22278766	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28574843, 30828910	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	19629158	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	29706602	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	19629158	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16541432	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	31171504	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	13130476, 25993664, 26161794, 26960450, 28506627, 9771212	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	28687435	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	24908204	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16490887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	14716759	★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	19629158	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	23362284, 26928377, 28062682, 28278336, 28438823, 29162886, 29706602, 29762688, 30705045	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28817603	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	15337976	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20036705, 21699788	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	BEFREE	30215709	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	22219647	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	16947780	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	10725281	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	10750581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	22125590, 25844609, 29355683	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	22125590, 25844609, 29355683	★★★★★ ★☆☆☆☆ Found in Text Mining only

HLA-C (major histocompatibility complex, class I, C)