UBE2K (ubiquitin conjugating enzyme E2 K)

Gene

• Entrez ID: 3093
• Gene name: Ubiquitin conjugating enzyme E2 K
• Gene symbol: UBE2K
• Synonyms (NCBI Gene): E2-25K, HIP2, HYPG, LIG, UBC1
• Chromosome: 4
• Chromosome location: 4p14
• Summary: The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington`s disease. Known functions for this protein include

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023304	hsa-miR-122-5p	Proteomics	21750653
MIRT029298	hsa-miR-26b-5p	Microarray	19088304
MIRT044916	hsa-miR-186-5p	CLASH	23622248
MIRT256046	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT256050	hsa-miR-4485-3p	PAR-CLIP	20371350
MIRT256048	hsa-miR-337-5p	PAR-CLIP	20371350
MIRT520359	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT356465	hsa-miR-600	PAR-CLIP	20371350
MIRT310105	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT520354	hsa-miR-5095	PAR-CLIP	20371350
MIRT520353	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT256046	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT256050	hsa-miR-4485-3p	PAR-CLIP	20371350
MIRT256048	hsa-miR-337-5p	PAR-CLIP	20371350
MIRT520359	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT520357	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT520356	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT520355	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT256051	hsa-miR-4667-3p	PAR-CLIP	20371350
MIRT356465	hsa-miR-600	PAR-CLIP	20371350
MIRT310105	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT520354	hsa-miR-5095	PAR-CLIP	20371350
MIRT520353	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT356466	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT256047	hsa-miR-155-3p	PAR-CLIP	20371350
MIRT520352	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT356464	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT520351	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT256046	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT256050	hsa-miR-4485-3p	PAR-CLIP	20371350
MIRT256048	hsa-miR-337-5p	PAR-CLIP	20371350
MIRT520359	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT520358	hsa-miR-660-5p	PAR-CLIP	20371350
MIRT520357	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT520356	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT520355	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT356465	hsa-miR-600	PAR-CLIP	20371350
MIRT310105	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT520354	hsa-miR-5095	PAR-CLIP	20371350
MIRT520353	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT356466	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT356464	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT520351	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT256046	hsa-miR-24-3p	PAR-CLIP	23446348
MIRT520360	hsa-miR-1273d	PAR-CLIP	23446348
MIRT256050	hsa-miR-4485-3p	PAR-CLIP	23446348
MIRT256048	hsa-miR-337-5p	PAR-CLIP	23446348
MIRT520359	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT520358	hsa-miR-660-5p	PAR-CLIP	23446348
MIRT520357	hsa-miR-1250-3p	PAR-CLIP	23446348
MIRT520356	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT520355	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT256051	hsa-miR-4667-3p	PAR-CLIP	23446348
MIRT356465	hsa-miR-600	PAR-CLIP	23446348
MIRT310105	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT520354	hsa-miR-5095	PAR-CLIP	23446348
MIRT520353	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT356466	hsa-miR-6826-3p	PAR-CLIP	23446348
MIRT256047	hsa-miR-155-3p	PAR-CLIP	23446348
MIRT520352	hsa-miR-374a-3p	PAR-CLIP	23446348
MIRT356464	hsa-miR-3679-3p	PAR-CLIP	23446348
MIRT520351	hsa-miR-4446-5p	PAR-CLIP	23446348
MIRT448337	hsa-miR-3662	PAR-CLIP	22100165
MIRT310088	hsa-miR-4495	PAR-CLIP	22100165
MIRT356440	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT356444	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT356441	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448336	hsa-miR-6759-3p	PAR-CLIP	22100165
MIRT212831	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT448335	hsa-miR-3924	PAR-CLIP	22100165
MIRT448334	hsa-miR-192-5p	PAR-CLIP	22100165
MIRT448333	hsa-miR-215-5p	PAR-CLIP	22100165
MIRT448332	hsa-miR-1273e	PAR-CLIP	22100165
MIRT256046	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT256050	hsa-miR-4485-3p	PAR-CLIP	20371350
MIRT256048	hsa-miR-337-5p	PAR-CLIP	20371350
MIRT520359	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT356465	hsa-miR-600	PAR-CLIP	20371350
MIRT310105	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT520354	hsa-miR-5095	PAR-CLIP	20371350
MIRT520353	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT256046	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT256050	hsa-miR-4485-3p	PAR-CLIP	20371350
MIRT256048	hsa-miR-337-5p	PAR-CLIP	20371350
MIRT520359	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT520357	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT520356	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT520355	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT256051	hsa-miR-4667-3p	PAR-CLIP	20371350
MIRT356465	hsa-miR-600	PAR-CLIP	20371350
MIRT310105	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT520354	hsa-miR-5095	PAR-CLIP	20371350
MIRT520353	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT356466	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT256047	hsa-miR-155-3p	PAR-CLIP	20371350
MIRT520352	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT356464	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT520351	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT256046	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT256050	hsa-miR-4485-3p	PAR-CLIP	20371350
MIRT256048	hsa-miR-337-5p	PAR-CLIP	20371350
MIRT520359	hsa-miR-4700-3p	PAR-CLIP	20371350
MIRT520358	hsa-miR-660-5p	PAR-CLIP	20371350
MIRT520357	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT520356	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT520355	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT356465	hsa-miR-600	PAR-CLIP	20371350
MIRT310105	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT520354	hsa-miR-5095	PAR-CLIP	20371350
MIRT520353	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT356466	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT356464	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT520351	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT256046	hsa-miR-24-3p	PAR-CLIP	23446348
MIRT520360	hsa-miR-1273d	PAR-CLIP	23446348
MIRT256050	hsa-miR-4485-3p	PAR-CLIP	23446348
MIRT256048	hsa-miR-337-5p	PAR-CLIP	23446348
MIRT520359	hsa-miR-4700-3p	PAR-CLIP	23446348
MIRT520358	hsa-miR-660-5p	PAR-CLIP	23446348
MIRT520357	hsa-miR-1250-3p	PAR-CLIP	23446348
MIRT520356	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT520355	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT256051	hsa-miR-4667-3p	PAR-CLIP	23446348
MIRT356465	hsa-miR-600	PAR-CLIP	23446348
MIRT310105	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT520354	hsa-miR-5095	PAR-CLIP	23446348
MIRT520353	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT356466	hsa-miR-6826-3p	PAR-CLIP	23446348
MIRT256047	hsa-miR-155-3p	PAR-CLIP	23446348
MIRT520352	hsa-miR-374a-3p	PAR-CLIP	23446348
MIRT356464	hsa-miR-3679-3p	PAR-CLIP	23446348
MIRT520351	hsa-miR-4446-5p	PAR-CLIP	23446348
MIRT448337	hsa-miR-3662	PAR-CLIP	22100165
MIRT310088	hsa-miR-4495	PAR-CLIP	22100165
MIRT356440	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT356444	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT356441	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448336	hsa-miR-6759-3p	PAR-CLIP	22100165
MIRT212831	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT448335	hsa-miR-3924	PAR-CLIP	22100165
MIRT448334	hsa-miR-192-5p	PAR-CLIP	22100165
MIRT448333	hsa-miR-215-5p	PAR-CLIP	22100165
MIRT448332	hsa-miR-1273e	PAR-CLIP	22100165
MIRT1468056	hsa-miR-10a	CLIP-seq
MIRT1468057	hsa-miR-10b	CLIP-seq
MIRT1468058	hsa-miR-1225-5p	CLIP-seq
MIRT1468059	hsa-miR-1234	CLIP-seq
MIRT1468060	hsa-miR-1263	CLIP-seq
MIRT1468061	hsa-miR-129-5p	CLIP-seq
MIRT1468062	hsa-miR-1298	CLIP-seq
MIRT1468063	hsa-miR-1305	CLIP-seq
MIRT1468064	hsa-miR-133a	CLIP-seq
MIRT1468065	hsa-miR-133b	CLIP-seq
MIRT1468066	hsa-miR-149	CLIP-seq
MIRT1468067	hsa-miR-1910	CLIP-seq
MIRT1468068	hsa-miR-194	CLIP-seq
MIRT1468069	hsa-miR-203	CLIP-seq
MIRT1468070	hsa-miR-205	CLIP-seq
MIRT1468071	hsa-miR-2053	CLIP-seq
MIRT1468072	hsa-miR-21	CLIP-seq
MIRT1468073	hsa-miR-214	CLIP-seq
MIRT1468074	hsa-miR-2278	CLIP-seq
MIRT1468075	hsa-miR-29a	CLIP-seq
MIRT1468076	hsa-miR-29b	CLIP-seq
MIRT1468077	hsa-miR-29c	CLIP-seq
MIRT1468078	hsa-miR-302f	CLIP-seq
MIRT1468079	hsa-miR-3065-5p	CLIP-seq
MIRT1468080	hsa-miR-3074-3p	CLIP-seq
MIRT1468081	hsa-miR-30a	CLIP-seq
MIRT1468082	hsa-miR-30b	CLIP-seq
MIRT1468083	hsa-miR-30c	CLIP-seq
MIRT1468084	hsa-miR-30d	CLIP-seq
MIRT1468085	hsa-miR-30e	CLIP-seq
MIRT1468086	hsa-miR-31	CLIP-seq
MIRT1468087	hsa-miR-3123	CLIP-seq
MIRT1468088	hsa-miR-3129-3p	CLIP-seq
MIRT1468089	hsa-miR-3135	CLIP-seq
MIRT1468090	hsa-miR-3157-3p	CLIP-seq
MIRT1468091	hsa-miR-3162-3p	CLIP-seq
MIRT1468092	hsa-miR-3163	CLIP-seq
MIRT1468093	hsa-miR-3164	CLIP-seq
MIRT1468094	hsa-miR-3166	CLIP-seq
MIRT1468095	hsa-miR-323-3p	CLIP-seq
MIRT1468096	hsa-miR-330-3p	CLIP-seq
MIRT1468097	hsa-miR-338-3p	CLIP-seq
MIRT1468098	hsa-miR-34a	CLIP-seq
MIRT1468099	hsa-miR-34c-5p	CLIP-seq
MIRT1468100	hsa-miR-3591-3p	CLIP-seq
MIRT1468101	hsa-miR-3607-3p	CLIP-seq
MIRT1468102	hsa-miR-3619-5p	CLIP-seq
MIRT1468103	hsa-miR-3907	CLIP-seq
MIRT1468104	hsa-miR-3941	CLIP-seq
MIRT1468105	hsa-miR-4267	CLIP-seq
MIRT1468106	hsa-miR-4268	CLIP-seq
MIRT1468107	hsa-miR-4276	CLIP-seq
MIRT1468108	hsa-miR-4282	CLIP-seq
MIRT1468109	hsa-miR-4291	CLIP-seq
MIRT1468110	hsa-miR-4307	CLIP-seq
MIRT1468111	hsa-miR-4308	CLIP-seq
MIRT1468112	hsa-miR-4423-3p	CLIP-seq
MIRT1468113	hsa-miR-4436b-5p	CLIP-seq
MIRT1468114	hsa-miR-4448	CLIP-seq
MIRT1468115	hsa-miR-449a	CLIP-seq
MIRT1468116	hsa-miR-449b	CLIP-seq
MIRT1468117	hsa-miR-450b-5p	CLIP-seq
MIRT1468118	hsa-miR-452	CLIP-seq
MIRT1468119	hsa-miR-4530	CLIP-seq
MIRT1468120	hsa-miR-455-3p	CLIP-seq
MIRT1468121	hsa-miR-4637	CLIP-seq
MIRT1468122	hsa-miR-4659a-3p	CLIP-seq
MIRT1468123	hsa-miR-4659b-3p	CLIP-seq
MIRT1468124	hsa-miR-466	CLIP-seq
MIRT1468125	hsa-miR-4660	CLIP-seq
MIRT1468126	hsa-miR-4672	CLIP-seq
MIRT1468127	hsa-miR-4676-3p	CLIP-seq
MIRT1468128	hsa-miR-4679	CLIP-seq
MIRT1468129	hsa-miR-4693-5p	CLIP-seq
MIRT1468130	hsa-miR-4694-3p	CLIP-seq
MIRT1468131	hsa-miR-4696	CLIP-seq
MIRT1468132	hsa-miR-4699-3p	CLIP-seq
MIRT1468133	hsa-miR-4711-5p	CLIP-seq
MIRT1468134	hsa-miR-4714-3p	CLIP-seq
MIRT1468135	hsa-miR-4763-5p	CLIP-seq
MIRT1468136	hsa-miR-4769-3p	CLIP-seq
MIRT1468137	hsa-miR-4781-3p	CLIP-seq
MIRT1468138	hsa-miR-4795-3p	CLIP-seq
MIRT1468139	hsa-miR-4797-5p	CLIP-seq
MIRT1468140	hsa-miR-495	CLIP-seq
MIRT1468141	hsa-miR-507	CLIP-seq
MIRT1468142	hsa-miR-513a-3p	CLIP-seq
MIRT1468143	hsa-miR-515-5p	CLIP-seq
MIRT1468144	hsa-miR-516a-3p	CLIP-seq
MIRT1468145	hsa-miR-522	CLIP-seq
MIRT1468146	hsa-miR-539	CLIP-seq
MIRT1468147	hsa-miR-548a-5p	CLIP-seq
MIRT1468148	hsa-miR-548aa	CLIP-seq
MIRT1468149	hsa-miR-548ab	CLIP-seq
MIRT1468150	hsa-miR-548ac	CLIP-seq
MIRT1468151	hsa-miR-548ak	CLIP-seq
MIRT1468152	hsa-miR-548b-5p	CLIP-seq
MIRT1468153	hsa-miR-548c-3p	CLIP-seq
MIRT1468154	hsa-miR-548c-5p	CLIP-seq
MIRT1468155	hsa-miR-548d-3p	CLIP-seq
MIRT1468156	hsa-miR-548d-5p	CLIP-seq
MIRT1468157	hsa-miR-548h	CLIP-seq
MIRT1468158	hsa-miR-548i	CLIP-seq
MIRT1468159	hsa-miR-548j	CLIP-seq
MIRT1468160	hsa-miR-548k	CLIP-seq
MIRT1468161	hsa-miR-548l	CLIP-seq
MIRT1468162	hsa-miR-548w	CLIP-seq
MIRT1468163	hsa-miR-548y	CLIP-seq
MIRT1468164	hsa-miR-548z	CLIP-seq
MIRT1468165	hsa-miR-555	CLIP-seq
MIRT1468166	hsa-miR-557	CLIP-seq
MIRT1468167	hsa-miR-559	CLIP-seq
MIRT1468168	hsa-miR-562	CLIP-seq
MIRT1468169	hsa-miR-569	CLIP-seq
MIRT1468170	hsa-miR-577	CLIP-seq
MIRT1468171	hsa-miR-579	CLIP-seq
MIRT1468172	hsa-miR-590-5p	CLIP-seq
MIRT1468173	hsa-miR-605	CLIP-seq
MIRT1468174	hsa-miR-617	CLIP-seq
MIRT1468175	hsa-miR-619	CLIP-seq
MIRT1468176	hsa-miR-622	CLIP-seq
MIRT1468177	hsa-miR-646	CLIP-seq
MIRT1468178	hsa-miR-656	CLIP-seq
MIRT1468179	hsa-miR-664	CLIP-seq
MIRT1468180	hsa-miR-761	CLIP-seq
MIRT1468181	hsa-miR-766	CLIP-seq
MIRT1468182	hsa-miR-767-5p	CLIP-seq
MIRT1468183	hsa-miR-802	CLIP-seq
MIRT1468184	hsa-miR-922	CLIP-seq
MIRT1468064	hsa-miR-133a	CLIP-seq
MIRT1468065	hsa-miR-133b	CLIP-seq
MIRT1468185	hsa-miR-142-5p	CLIP-seq
MIRT1468186	hsa-miR-1908	CLIP-seq
MIRT1468187	hsa-miR-24	CLIP-seq
MIRT1468081	hsa-miR-30a	CLIP-seq
MIRT1468082	hsa-miR-30b	CLIP-seq
MIRT1468083	hsa-miR-30c	CLIP-seq
MIRT1468084	hsa-miR-30d	CLIP-seq
MIRT1468085	hsa-miR-30e	CLIP-seq
MIRT1468188	hsa-miR-337-3p	CLIP-seq
MIRT1468101	hsa-miR-3607-3p	CLIP-seq
MIRT1468189	hsa-miR-3685	CLIP-seq
MIRT1468190	hsa-miR-384	CLIP-seq
MIRT1468108	hsa-miR-4282	CLIP-seq
MIRT1468191	hsa-miR-4447	CLIP-seq
MIRT1468192	hsa-miR-4472	CLIP-seq
MIRT1468193	hsa-miR-4485	CLIP-seq
MIRT1468194	hsa-miR-4646-5p	CLIP-seq
MIRT1468195	hsa-miR-4651	CLIP-seq
MIRT1468196	hsa-miR-4708-3p	CLIP-seq
MIRT1468197	hsa-miR-4755-5p	CLIP-seq
MIRT1468198	hsa-miR-4787-5p	CLIP-seq
MIRT1468199	hsa-miR-490-3p	CLIP-seq
MIRT1468144	hsa-miR-516a-3p	CLIP-seq
MIRT1468200	hsa-miR-548ag	CLIP-seq
MIRT1468201	hsa-miR-548ai	CLIP-seq
MIRT1468153	hsa-miR-548c-3p	CLIP-seq
MIRT1468202	hsa-miR-561	CLIP-seq
MIRT1468203	hsa-miR-608	CLIP-seq
MIRT1468204	hsa-miR-663	CLIP-seq
MIRT1555316	hsa-miR-3653	CLIP-seq
MIRT1468079	hsa-miR-3065-5p	CLIP-seq
MIRT2140658	hsa-miR-4728-3p	CLIP-seq
MIRT2140659	hsa-miR-603	CLIP-seq
MIRT1468079	hsa-miR-3065-5p	CLIP-seq
MIRT1468096	hsa-miR-330-3p	CLIP-seq
MIRT1468100	hsa-miR-3591-3p	CLIP-seq
MIRT2140660	hsa-miR-4427	CLIP-seq
MIRT2140661	hsa-miR-4680-3p	CLIP-seq
MIRT1468132	hsa-miR-4699-3p	CLIP-seq
MIRT2140659	hsa-miR-603	CLIP-seq
MIRT1468176	hsa-miR-622	CLIP-seq
MIRT2140662	hsa-miR-1227	CLIP-seq
MIRT2140663	hsa-miR-1290	CLIP-seq
MIRT2140664	hsa-miR-1297	CLIP-seq
MIRT1468063	hsa-miR-1305	CLIP-seq
MIRT1468069	hsa-miR-203	CLIP-seq
MIRT1468072	hsa-miR-21	CLIP-seq
MIRT2140665	hsa-miR-23a	CLIP-seq
MIRT2140666	hsa-miR-23b	CLIP-seq
MIRT2140667	hsa-miR-23c	CLIP-seq
MIRT2140668	hsa-miR-26a	CLIP-seq
MIRT2140669	hsa-miR-26b	CLIP-seq
MIRT2140670	hsa-miR-3120-3p	CLIP-seq
MIRT1468088	hsa-miR-3129-3p	CLIP-seq
MIRT1468100	hsa-miR-3591-3p	CLIP-seq
MIRT2140671	hsa-miR-3607-5p	CLIP-seq
MIRT2140672	hsa-miR-361-5p	CLIP-seq
MIRT2140673	hsa-miR-4269	CLIP-seq
MIRT2140674	hsa-miR-4272	CLIP-seq
MIRT2140660	hsa-miR-4427	CLIP-seq
MIRT2140675	hsa-miR-4465	CLIP-seq
MIRT2140676	hsa-miR-455-5p	CLIP-seq
MIRT2140677	hsa-miR-4668-5p	CLIP-seq
MIRT2140661	hsa-miR-4680-3p	CLIP-seq
MIRT2140658	hsa-miR-4728-3p	CLIP-seq
MIRT2140678	hsa-miR-4775	CLIP-seq
MIRT1468139	hsa-miR-4797-5p	CLIP-seq
MIRT1468142	hsa-miR-513a-3p	CLIP-seq
MIRT2140679	hsa-miR-548g	CLIP-seq
MIRT1468202	hsa-miR-561	CLIP-seq
MIRT2140680	hsa-miR-590-3p	CLIP-seq
MIRT1468172	hsa-miR-590-5p	CLIP-seq
MIRT1468176	hsa-miR-622	CLIP-seq
MIRT2140681	hsa-miR-944	CLIP-seq
MIRT2361625	hsa-miR-103a	CLIP-seq
MIRT2361626	hsa-miR-107	CLIP-seq
MIRT2361627	hsa-miR-1206	CLIP-seq
MIRT2140662	hsa-miR-1227	CLIP-seq
MIRT2361628	hsa-miR-1228	CLIP-seq
MIRT2361629	hsa-miR-1267	CLIP-seq
MIRT2140664	hsa-miR-1297	CLIP-seq
MIRT2361630	hsa-miR-1324	CLIP-seq
MIRT2361631	hsa-miR-181a	CLIP-seq
MIRT2361632	hsa-miR-181b	CLIP-seq
MIRT2361633	hsa-miR-181c	CLIP-seq
MIRT2361634	hsa-miR-181d	CLIP-seq
MIRT1468069	hsa-miR-203	CLIP-seq
MIRT2140665	hsa-miR-23a	CLIP-seq
MIRT2140666	hsa-miR-23b	CLIP-seq
MIRT2140667	hsa-miR-23c	CLIP-seq
MIRT2140668	hsa-miR-26a	CLIP-seq
MIRT2140669	hsa-miR-26b	CLIP-seq
MIRT1468075	hsa-miR-29a	CLIP-seq
MIRT1468076	hsa-miR-29b	CLIP-seq
MIRT1468077	hsa-miR-29c	CLIP-seq
MIRT1468078	hsa-miR-302f	CLIP-seq
MIRT2361635	hsa-miR-3064-3p	CLIP-seq
MIRT1468079	hsa-miR-3065-5p	CLIP-seq
MIRT1468086	hsa-miR-31	CLIP-seq
MIRT2140670	hsa-miR-3120-3p	CLIP-seq
MIRT1468087	hsa-miR-3123	CLIP-seq
MIRT2361636	hsa-miR-3156-5p	CLIP-seq
MIRT1468094	hsa-miR-3166	CLIP-seq
MIRT2361637	hsa-miR-3179	CLIP-seq
MIRT1468096	hsa-miR-330-3p	CLIP-seq
MIRT1468098	hsa-miR-34a	CLIP-seq
MIRT2361638	hsa-miR-34c-3p	CLIP-seq
MIRT1468099	hsa-miR-34c-5p	CLIP-seq
MIRT1468100	hsa-miR-3591-3p	CLIP-seq
MIRT2361639	hsa-miR-3613-3p	CLIP-seq
MIRT2361640	hsa-miR-3616-5p	CLIP-seq
MIRT2361641	hsa-miR-3622a-3p	CLIP-seq
MIRT2361642	hsa-miR-3622b-3p	CLIP-seq
MIRT2361643	hsa-miR-3647-5p	CLIP-seq
MIRT2361644	hsa-miR-3658	CLIP-seq
MIRT2361645	hsa-miR-3671	CLIP-seq
MIRT2361646	hsa-miR-369-3p	CLIP-seq
MIRT2361647	hsa-miR-371b-5p	CLIP-seq
MIRT2361648	hsa-miR-374c	CLIP-seq
MIRT2361649	hsa-miR-3920	CLIP-seq
MIRT2361650	hsa-miR-411	CLIP-seq
MIRT2361651	hsa-miR-4262	CLIP-seq
MIRT2140673	hsa-miR-4269	CLIP-seq
MIRT2361652	hsa-miR-4280	CLIP-seq
MIRT2361653	hsa-miR-4326	CLIP-seq
MIRT2361654	hsa-miR-433	CLIP-seq
MIRT2140660	hsa-miR-4427	CLIP-seq
MIRT2361655	hsa-miR-4434	CLIP-seq
MIRT2361656	hsa-miR-4450	CLIP-seq
MIRT2140675	hsa-miR-4465	CLIP-seq
MIRT1468115	hsa-miR-449a	CLIP-seq
MIRT1468116	hsa-miR-449b	CLIP-seq
MIRT2361657	hsa-miR-4516	CLIP-seq
MIRT2361658	hsa-miR-4531	CLIP-seq
MIRT2361659	hsa-miR-4667-5p	CLIP-seq
MIRT2140677	hsa-miR-4668-5p	CLIP-seq
MIRT2140661	hsa-miR-4680-3p	CLIP-seq
MIRT2361660	hsa-miR-4686	CLIP-seq
MIRT2361661	hsa-miR-4700-5p	CLIP-seq
MIRT2361662	hsa-miR-4703-3p	CLIP-seq
MIRT2361663	hsa-miR-4711-3p	CLIP-seq
MIRT2140658	hsa-miR-4728-3p	CLIP-seq
MIRT2361664	hsa-miR-4742-5p	CLIP-seq
MIRT2361665	hsa-miR-4760-3p	CLIP-seq
MIRT2361666	hsa-miR-4795-5p	CLIP-seq
MIRT2361667	hsa-miR-508-3p	CLIP-seq
MIRT2361668	hsa-miR-5096	CLIP-seq
MIRT2361669	hsa-miR-513c	CLIP-seq
MIRT2361670	hsa-miR-514b-5p	CLIP-seq
MIRT1468148	hsa-miR-548aa	CLIP-seq
MIRT1468150	hsa-miR-548ac	CLIP-seq
MIRT1468153	hsa-miR-548c-3p	CLIP-seq
MIRT1468155	hsa-miR-548d-3p	CLIP-seq
MIRT2140679	hsa-miR-548g	CLIP-seq
MIRT2361671	hsa-miR-548t	CLIP-seq
MIRT1468164	hsa-miR-548z	CLIP-seq
MIRT2361672	hsa-miR-573	CLIP-seq
MIRT2140659	hsa-miR-603	CLIP-seq
MIRT1468174	hsa-miR-617	CLIP-seq
MIRT1468176	hsa-miR-622	CLIP-seq
MIRT2361673	hsa-miR-625	CLIP-seq
MIRT2361674	hsa-miR-642b	CLIP-seq
MIRT2361675	hsa-miR-655	CLIP-seq
MIRT1468182	hsa-miR-767-5p	CLIP-seq
MIRT2361676	hsa-miR-888	CLIP-seq
MIRT2361677	hsa-miR-936	CLIP-seq
MIRT2140681	hsa-miR-944	CLIP-seq
MIRT1468079	hsa-miR-3065-5p	CLIP-seq
MIRT1468086	hsa-miR-31	CLIP-seq
MIRT2140670	hsa-miR-3120-3p	CLIP-seq
MIRT1468094	hsa-miR-3166	CLIP-seq
MIRT1468096	hsa-miR-330-3p	CLIP-seq
MIRT1468100	hsa-miR-3591-3p	CLIP-seq
MIRT2361647	hsa-miR-371b-5p	CLIP-seq
MIRT2361678	hsa-miR-3942-5p	CLIP-seq
MIRT2140676	hsa-miR-455-5p	CLIP-seq
MIRT1468132	hsa-miR-4699-3p	CLIP-seq
MIRT2361679	hsa-miR-4703-5p	CLIP-seq
MIRT2140658	hsa-miR-4728-3p	CLIP-seq
MIRT2140659	hsa-miR-603	CLIP-seq
MIRT1468176	hsa-miR-622	CLIP-seq
MIRT2140681	hsa-miR-944	CLIP-seq
MIRT2361647	hsa-miR-371b-5p	CLIP-seq
MIRT2361676	hsa-miR-888	CLIP-seq
MIRT2140681	hsa-miR-944	CLIP-seq
MIRT2655354	hsa-miR-101	CLIP-seq
MIRT2140662	hsa-miR-1227	CLIP-seq
MIRT1468060	hsa-miR-1263	CLIP-seq
MIRT2655355	hsa-miR-136	CLIP-seq
MIRT1468185	hsa-miR-142-5p	CLIP-seq
MIRT2655356	hsa-miR-144	CLIP-seq
MIRT2655357	hsa-miR-151-3p	CLIP-seq
MIRT2655358	hsa-miR-186	CLIP-seq
MIRT2140665	hsa-miR-23a	CLIP-seq
MIRT2140666	hsa-miR-23b	CLIP-seq
MIRT2140667	hsa-miR-23c	CLIP-seq
MIRT1468079	hsa-miR-3065-5p	CLIP-seq
MIRT2655359	hsa-miR-3140-3p	CLIP-seq
MIRT2655360	hsa-miR-3140-5p	CLIP-seq
MIRT2655361	hsa-miR-3144-3p	CLIP-seq
MIRT2655362	hsa-miR-3152-3p	CLIP-seq
MIRT2361636	hsa-miR-3156-5p	CLIP-seq
MIRT2655363	hsa-miR-342-5p	CLIP-seq
MIRT2655364	hsa-miR-362-5p	CLIP-seq
MIRT2655365	hsa-miR-3674	CLIP-seq
MIRT2655366	hsa-miR-3676	CLIP-seq
MIRT2655367	hsa-miR-3688-3p	CLIP-seq
MIRT2361647	hsa-miR-371b-5p	CLIP-seq
MIRT2361648	hsa-miR-374c	CLIP-seq
MIRT2655368	hsa-miR-421	CLIP-seq
MIRT2655369	hsa-miR-4261	CLIP-seq
MIRT2140674	hsa-miR-4272	CLIP-seq
MIRT2655370	hsa-miR-4477a	CLIP-seq
MIRT2655371	hsa-miR-4503	CLIP-seq
MIRT1468122	hsa-miR-4659a-3p	CLIP-seq
MIRT1468123	hsa-miR-4659b-3p	CLIP-seq
MIRT2655372	hsa-miR-4664-5p	CLIP-seq
MIRT2655373	hsa-miR-4668-3p	CLIP-seq
MIRT2361660	hsa-miR-4686	CLIP-seq
MIRT2655374	hsa-miR-4698	CLIP-seq
MIRT2655375	hsa-miR-4709-5p	CLIP-seq
MIRT2655376	hsa-miR-4729	CLIP-seq
MIRT2140678	hsa-miR-4775	CLIP-seq
MIRT2655377	hsa-miR-500b	CLIP-seq
MIRT2655378	hsa-miR-501-5p	CLIP-seq
MIRT2361668	hsa-miR-5096	CLIP-seq
MIRT1468147	hsa-miR-548a-5p	CLIP-seq
MIRT1468149	hsa-miR-548ab	CLIP-seq
MIRT1468151	hsa-miR-548ak	CLIP-seq
MIRT1468152	hsa-miR-548b-5p	CLIP-seq
MIRT1468154	hsa-miR-548c-5p	CLIP-seq
MIRT1468156	hsa-miR-548d-5p	CLIP-seq
MIRT1468157	hsa-miR-548h	CLIP-seq
MIRT1468158	hsa-miR-548i	CLIP-seq
MIRT1468159	hsa-miR-548j	CLIP-seq
MIRT1468160	hsa-miR-548k	CLIP-seq
MIRT1468161	hsa-miR-548l	CLIP-seq
MIRT1468162	hsa-miR-548w	CLIP-seq
MIRT1468163	hsa-miR-548y	CLIP-seq
MIRT1468167	hsa-miR-559	CLIP-seq
MIRT1468202	hsa-miR-561	CLIP-seq
MIRT1468168	hsa-miR-562	CLIP-seq
MIRT2140680	hsa-miR-590-3p	CLIP-seq
MIRT2140659	hsa-miR-603	CLIP-seq
MIRT2361674	hsa-miR-642b	CLIP-seq
MIRT2361675	hsa-miR-655	CLIP-seq
MIRT1468178	hsa-miR-656	CLIP-seq
MIRT2361676	hsa-miR-888	CLIP-seq
MIRT2140681	hsa-miR-944	CLIP-seq
MIRT2361625	hsa-miR-103a	CLIP-seq
MIRT2361626	hsa-miR-107	CLIP-seq
MIRT2140662	hsa-miR-1227	CLIP-seq
MIRT2361628	hsa-miR-1228	CLIP-seq
MIRT1468060	hsa-miR-1263	CLIP-seq
MIRT2694639	hsa-miR-15a	CLIP-seq
MIRT2694640	hsa-miR-15b	CLIP-seq
MIRT2694641	hsa-miR-16	CLIP-seq
MIRT2694642	hsa-miR-195	CLIP-seq
MIRT2140665	hsa-miR-23a	CLIP-seq
MIRT2140666	hsa-miR-23b	CLIP-seq
MIRT2140667	hsa-miR-23c	CLIP-seq
MIRT2361635	hsa-miR-3064-3p	CLIP-seq
MIRT1468079	hsa-miR-3065-5p	CLIP-seq
MIRT2655359	hsa-miR-3140-3p	CLIP-seq
MIRT2655360	hsa-miR-3140-5p	CLIP-seq
MIRT2655361	hsa-miR-3144-3p	CLIP-seq
MIRT2361636	hsa-miR-3156-5p	CLIP-seq
MIRT2361641	hsa-miR-3622a-3p	CLIP-seq
MIRT2361642	hsa-miR-3622b-3p	CLIP-seq
MIRT2361647	hsa-miR-371b-5p	CLIP-seq
MIRT2361649	hsa-miR-3920	CLIP-seq
MIRT2655368	hsa-miR-421	CLIP-seq
MIRT2694643	hsa-miR-424	CLIP-seq
MIRT2140674	hsa-miR-4272	CLIP-seq
MIRT2655370	hsa-miR-4477a	CLIP-seq
MIRT2694644	hsa-miR-4524	CLIP-seq
MIRT1468122	hsa-miR-4659a-3p	CLIP-seq
MIRT1468123	hsa-miR-4659b-3p	CLIP-seq
MIRT2655373	hsa-miR-4668-3p	CLIP-seq
MIRT2361660	hsa-miR-4686	CLIP-seq
MIRT2655374	hsa-miR-4698	CLIP-seq
MIRT2694645	hsa-miR-4778-3p	CLIP-seq
MIRT2694646	hsa-miR-497	CLIP-seq
MIRT2694647	hsa-miR-503	CLIP-seq
MIRT2361668	hsa-miR-5096	CLIP-seq
MIRT2140679	hsa-miR-548g	CLIP-seq
MIRT2140659	hsa-miR-603	CLIP-seq
MIRT2361674	hsa-miR-642b	CLIP-seq
MIRT1468177	hsa-miR-646	CLIP-seq
MIRT1468178	hsa-miR-656	CLIP-seq
MIRT2361676	hsa-miR-888	CLIP-seq
MIRT2140681	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	20061386
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	8702625
GO:0005515	Function	Protein binding	IPI	17500595, 19549727, 20965177, 23275563, 24446487, 25416956, 27107012, 27173435, 28514442, 32296183, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IC	24882218
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	8702625
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IDA	24882218
GO:0010994	Process	Free ubiquitin chain polymerization	IDA	24882218
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16714285, 17873885, 18410486
GO:0032433	Component	Filopodium tip	IEA
GO:0032434	Process	Regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IDA	17873885
GO:0035458	Process	Cellular response to interferon-beta	IMP	24882218
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	23386060
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	24882218
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IMP	24882218
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	24882218
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IMP	26707646

Other IDs

• MIM: 602846
• HGNC: 4914
• e!Ensembl: ENSG00000078140

Protein

• UniProt ID: P61086
• Protein name: Ubiquitin-conjugating enzyme E2 K (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme K) (Huntingtin-interacting protein 2) (HIP-2) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-25 kDa) (Ubiquitin-conjugating enzyme E2(25K)) (Ubiquitin-conjugati
• Protein function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquit
• PDB: 1YLA, 2O25, 3E46, 3F92, 3K9O, 3K9P, 5DFL, 6IF1, 6JB6, 6JB7, 7MYF, 7MYH, 7OJX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00179	UQ_con	8 → 149	Ubiquitin-conjugating enzyme	Domain
  PF00627	UBA	161 → 197	UBA/TS-N domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues tested, including spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocytes, T-lymphocytes, monocytes, granulocytes and bone marrow mononuclear cells. Highly expressed in brai
• Sequence:

  MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
  KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
  EPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVI
  VALSSKSWDVETATELLLSN

• Sequence length: 200

Pathways

KEGG:

Ubiquitin mediated proteolysis

Reactome:

Synthesis of active ubiquitin: roles of E1 and E2 enzymes
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOCRINE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE INFERTILITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	37549144	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angelman Syndrome	Angelman Syndrome	BEFREE	10089011, 10737998, 11748306, 15150776, 15213998, 20635355, 21072004, 21493713, 23256887, 29388081, 31640736, 8988172, 9110176, 9545097, 9763493, 9891052		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman syndrome	Pubtator	18193166	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	33308194	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29388081		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	23495136	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29388081		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	BEFREE	16714300		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30467945		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18326623		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18326623	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20452352	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30467945		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11869177		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28169530		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21312234		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30804124	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29550110		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19083192, 21912958		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19083192, 21912958		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32271436	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17092742		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33049985	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25602517		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31057023		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	18193166		★☆☆☆☆ Found in Text Mining only
Liddle Syndrome	Liddle Syndrome	BEFREE	25602517		★☆☆☆☆ Found in Text Mining only
Limb-girdle muscular dystrophy type 2H	Sarcotubular myopathy	BEFREE	21984809		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20452352, 21312234		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21312234		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25045014	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16395405		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18326623		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19083192, 21912958		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11869177		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30467945		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11352657, 18780286, 24339722, 28928809		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	18193166		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	16395405		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33647537	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12902990, 15254018, 21281817, 21312234, 30467945		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30282965		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31640736		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30901725		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35941660	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30834083		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	21281817		★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma, sporadic	Papillary renal carcinoma	BEFREE	21281817		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11078524, 12730996, 12846976, 20889486, 22651796, 23046827, 30282965		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	11078524, 22651796	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	12937272, 15689351		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	12034719, 21091474	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	18230723		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	1379239	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30901725		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30901725		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19083192		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38577917	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15581609	Associate	★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	37773677	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25755750	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30467945	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15994823	Associate	★☆☆☆☆ Found in Text Mining only
VACTERL Association	VACTERL Association	BEFREE	31315107		★☆☆☆☆ Found in Text Mining only