HIF1A (hypoxia inducible factor 1 subunit alpha)

Gene

• Entrez ID: 3091
• Gene name: Hypoxia inducible factor 1 subunit alpha
• Gene symbol: HIF1A
• Synonyms (NCBI Gene): HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
• Chromosome: 14
• Chromosome location: 14q23.2
• Summary: This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000498	hsa-miR-20b-5p	qRT-PCR, ELISA, ChIP, Western blot	20232316
MIRT000496	hsa-miR-519c-3p	Luciferase reporter assay, qRT-PCR, Western blot	20233879
MIRT004487	hsa-miR-107	qRT-PCR, Luciferase reporter assay, Western blot, Northern blot	20308559
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, Western blot, Northern blot	18632605
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, Western blot, Northern blot	18632605
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18632605
MIRT004588	hsa-miR-17-5p	Review	20144731
MIRT004587	hsa-miR-18a-5p	Review	20144731
MIRT004589	hsa-miR-19a-3p	Review	20144731
MIRT004590	hsa-miR-19b-3p	Review	20144731
MIRT000002	hsa-miR-20a-5p	Review	20144731
MIRT005926	hsa-miR-424-5p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20972335
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21847633
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21847633
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21847633
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21847633
MIRT006744	hsa-miR-138-5p	Luciferase reporter assay	21875287
MIRT006744	hsa-miR-138-5p	Luciferase reporter assay	21875287
MIRT007022	hsa-miR-199b-5p	Luciferase reporter assay	21557766
MIRT006744	hsa-miR-138-5p	Luciferase reporter assay	23389731
MIRT028216	hsa-miR-33a-5p	Sequencing	20371350
MIRT004587	hsa-miR-18a-5p	Sequencing	20371350
MIRT051936	hsa-let-7b-5p	CLASH	23622248
MIRT038587	hsa-miR-106b-3p	CLASH	23622248
MIRT038587	hsa-miR-106b-3p	CLASH	23622248
MIRT054349	hsa-miR-210-3p	QRTPCR, Western blot	23618526
MIRT004588	hsa-miR-17-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24252850
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24839982
MIRT437403	hsa-miR-22-3p	Immunofluorescence, qRT-PCR, Western blot	24496460
MIRT006138	hsa-miR-199a-5p	Immunohistochemistry, qRT-PCR, Western blot	24022342
MIRT070742	hsa-miR-93-5p	Microarray, qRT-PCR	22815788
MIRT437916	hsa-miR-21-5p	ChIP-seq	23726431
MIRT004588	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	23911400
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23911400
MIRT004588	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	23911400
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23911400
MIRT702964	hsa-miR-494-3p	HITS-CLIP	23313552
MIRT702963	hsa-miR-3609	HITS-CLIP	23313552
MIRT702962	hsa-miR-548ah-5p	HITS-CLIP	23313552
MIRT702961	hsa-miR-625-3p	HITS-CLIP	23313552
MIRT702960	hsa-miR-3128	HITS-CLIP	23313552
MIRT702959	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT702958	hsa-miR-558	HITS-CLIP	23313552
MIRT702957	hsa-miR-4487	HITS-CLIP	23313552
MIRT702956	hsa-miR-4470	HITS-CLIP	23313552
MIRT279539	hsa-miR-5681b	HITS-CLIP	23313552
MIRT138601	hsa-miR-8055	HITS-CLIP	23313552
MIRT279526	hsa-miR-151a-3p	PAR-CLIP	21572407
MIRT070774	hsa-miR-4282	PAR-CLIP	21572407
MIRT070721	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT547981	hsa-miR-4499	PAR-CLIP	21572407
MIRT547980	hsa-miR-4463	PAR-CLIP	21572407
MIRT191510	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT070723	hsa-miR-3668	PAR-CLIP	21572407
MIRT070728	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT547979	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT547978	hsa-miR-217	PAR-CLIP	21572407
MIRT547977	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT191501	hsa-miR-3662	PAR-CLIP	21572407
MIRT398180	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547976	hsa-miR-4418	PAR-CLIP	21572407
MIRT547975	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT547974	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT536882	hsa-miR-1322	PAR-CLIP	21572407
MIRT191495	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT557319	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT557318	hsa-miR-106a-3p	PAR-CLIP	21572407
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	21572407
MIRT070734	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT070739	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT557317	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT557316	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT557315	hsa-miR-940	PAR-CLIP	21572407
MIRT557314	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT557313	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT557312	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT070740	hsa-miR-6755-5p	PAR-CLIP	21572407
MIRT557311	hsa-miR-4464	PAR-CLIP	21572407
MIRT557310	hsa-miR-4748	PAR-CLIP	21572407
MIRT557309	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT070735	hsa-miR-3074-3p	PAR-CLIP	21572407
MIRT070737	hsa-miR-5094	PAR-CLIP	21572407
MIRT070730	hsa-miR-589-3p	PAR-CLIP	21572407
MIRT070733	hsa-miR-935	PAR-CLIP	21572407
MIRT070741	hsa-miR-6806-5p	PAR-CLIP	21572407
MIRT070731	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT279526	hsa-miR-151a-3p	PAR-CLIP	21572407
MIRT070774	hsa-miR-4282	PAR-CLIP	21572407
MIRT070721	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT547981	hsa-miR-4499	PAR-CLIP	21572407
MIRT547980	hsa-miR-4463	PAR-CLIP	21572407
MIRT191510	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT070723	hsa-miR-3668	PAR-CLIP	21572407
MIRT070728	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT547979	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT547978	hsa-miR-217	PAR-CLIP	21572407
MIRT547977	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT191501	hsa-miR-3662	PAR-CLIP	21572407
MIRT398180	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547976	hsa-miR-4418	PAR-CLIP	21572407
MIRT547975	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT547974	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT536882	hsa-miR-1322	PAR-CLIP	21572407
MIRT191495	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	22012620
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	22012620
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	22012620
MIRT191501	hsa-miR-3662	PAR-CLIP	22012620
MIRT398180	hsa-miR-5692a	PAR-CLIP	22012620
MIRT536882	hsa-miR-1322	PAR-CLIP	22012620
MIRT191495	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	22012620
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	22012620
MIRT070745	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT000002	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT070745	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT004588	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT000498	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT070742	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT070750	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT000002	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT398178	hsa-miR-155-5p	qRT-PCR, Immunohistochemistry, Western blot	25143000
MIRT735728	hsa-miR-429	qRT-PCR, Western blot	25550463
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay	26344589
MIRT731348	hsa-miR-142-5p	Luciferase reporter assay, Western blot	28069592
MIRT731348	hsa-miR-142-5p	Luciferase reporter assay, Western blot	28069592
MIRT731348	hsa-miR-142-5p	Luciferase reporter assay, Western blot	28069592
MIRT731348	hsa-miR-142-5p	Luciferase reporter assay, Western blot	28069592
MIRT731838	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	26292288
MIRT731838	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	26292288
MIRT731849	hsa-miR-433-3p	Luciferase reporter assay, qRT-PCR, Western blot	27815672
MIRT731849	hsa-miR-433-3p	Luciferase reporter assay, qRT-PCR, Western blot	27815672
MIRT004587	hsa-miR-18a-5p	Luciferase reporter assay	27080303
MIRT004587	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26622381
MIRT004587	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26622381
MIRT070743	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27325313
MIRT070745	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27325313
MIRT191495	hsa-miR-153-5p	Luciferase reporter assay, Western blot	27554040
MIRT191495	hsa-miR-153-5p	Luciferase reporter assay, Western blot	27554040
MIRT191495	hsa-miR-153-5p	Luciferase reporter assay, Western blot	27554040
MIRT191495	hsa-miR-153-5p	Luciferase reporter assay, Western blot	27554040
MIRT000498	hsa-miR-20b-5p	qRT-PCR	26793992
MIRT000498	hsa-miR-20b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26612965
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26783726
MIRT191496	hsa-miR-18b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27220837
MIRT191496	hsa-miR-18b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27220837
MIRT070742	hsa-miR-93-5p	Flow, Immunocytochemistry, Next Generation Sequencing (NGS), qRT-PCR	26815014
MIRT028216	hsa-miR-33a-5p	Luciferase reporter assay	25891797
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay	27122154
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay	27122154
MIRT732716	hsa-miR-135b-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR	32085620
MIRT732760	hsa-miR-31-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR	32085620
MIRT006744	hsa-miR-138-5p	Immunofluorescence, qRT-PCR	33919449
MIRT054349	hsa-miR-210-3p	Immunofluorescence, qRT-PCR	33919449
MIRT733182	hsa-miR-4646-5p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33875796
MIRT733668	hsa-miR-373-3p	ELISA, qRT-PCR	33997006
MIRT191501	hsa-miR-3662	Immunohistochemistry (IHC), qRT-PCR, Western blotting	33864618
MIRT000496	hsa-miR-519c-3p	qRT-PCR, Western blotting	33177098
MIRT398178	hsa-miR-155-5p	qRT-PCR	33062603
MIRT734281	hsa-miR-646	Luciferase reporter assay, qRT-PCR, Western blotting	32782496
MIRT054349	hsa-miR-210-3p	Immunoprecipitaion (IP), In situ hybridization, Luciferase reporter assay, Western blotting	31616934
MIRT734775	hsa-miR-130a-3p	Western blotting, RNA-seq, qRT-PCR, Flow cytometry, Immunocytochemistry (ICC)	33614244
MIRT734877	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	33438204
MIRT735674	hsa-miR-221-3p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization	32873879
MIRT735728	hsa-miR-429	Luciferase reporter assay, Western blotting, qRT-PCR	31903105
MIRT736183	hsa-miR-17-3p	Western blotting, Microarray, qRT-PCR	31916114
MIRT736184	hsa-miR-92a-3p	Western blotting, Microarray, qRT-PCR	31916114
MIRT004587	hsa-miR-18a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32210827
MIRT736307	hsa-miR-34a-3p	Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32102296
MIRT736597	hsa-miR-200c-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32960511
MIRT191501	hsa-miR-3662	Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	33993382
MIRT736947	hsa-miR-375	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32215815
MIRT737114	hsa-miR-346	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32403237
MIRT737147	hsa-miR-7641	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), qRT-PCR	34238918
MIRT737344	hsa-miR-18a-3p	Western blotting, Microarray, qRT-PCR	32226492
MIRT737533	hsa-miR-31-3p	Luciferase reporter assay, Immunofluorescence, qRT-PCR, In situ hybridization	32085620
MIRT004487	hsa-miR-107	Luciferase reporter assay, Immunofluorescence, qRT-PCR, In situ hybridization	32085620
MIRT732716	hsa-miR-135b-5p	Luciferase reporter assay, Immunofluorescence, qRT-PCR, In situ hybridization	32085620
MIRT737571	hsa-miR-30a-5p	Western blotting, qRT-PCR	31772711
MIRT702964	hsa-miR-494-3p	HITS-CLIP	23313552
MIRT702963	hsa-miR-3609	HITS-CLIP	23313552
MIRT702962	hsa-miR-548ah-5p	HITS-CLIP	23313552
MIRT702961	hsa-miR-625-3p	HITS-CLIP	23313552
MIRT702960	hsa-miR-3128	HITS-CLIP	23313552
MIRT702959	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT702958	hsa-miR-558	HITS-CLIP	23313552
MIRT702957	hsa-miR-4487	HITS-CLIP	23313552
MIRT702956	hsa-miR-4470	HITS-CLIP	23313552
MIRT279539	hsa-miR-5681b	HITS-CLIP	23313552
MIRT138601	hsa-miR-8055	HITS-CLIP	23313552
MIRT279526	hsa-miR-151a-3p	PAR-CLIP	21572407
MIRT070774	hsa-miR-4282	PAR-CLIP	21572407
MIRT070721	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT547981	hsa-miR-4499	PAR-CLIP	21572407
MIRT547980	hsa-miR-4463	PAR-CLIP	21572407
MIRT191510	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT070723	hsa-miR-3668	PAR-CLIP	21572407
MIRT070728	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT547979	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT547978	hsa-miR-217	PAR-CLIP	21572407
MIRT547977	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT191501	hsa-miR-3662	PAR-CLIP	21572407
MIRT398180	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547976	hsa-miR-4418	PAR-CLIP	21572407
MIRT547975	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT547974	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT536882	hsa-miR-1322	PAR-CLIP	21572407
MIRT191495	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT557319	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT557318	hsa-miR-106a-3p	PAR-CLIP	21572407
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	21572407
MIRT070734	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT070739	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT557317	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT557316	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT557315	hsa-miR-940	PAR-CLIP	21572407
MIRT557314	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT557313	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT557312	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT070740	hsa-miR-6755-5p	PAR-CLIP	21572407
MIRT557311	hsa-miR-4464	PAR-CLIP	21572407
MIRT557310	hsa-miR-4748	PAR-CLIP	21572407
MIRT557309	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT070735	hsa-miR-3074-3p	PAR-CLIP	21572407
MIRT070737	hsa-miR-5094	PAR-CLIP	21572407
MIRT070730	hsa-miR-589-3p	PAR-CLIP	21572407
MIRT070733	hsa-miR-935	PAR-CLIP	21572407
MIRT070741	hsa-miR-6806-5p	PAR-CLIP	21572407
MIRT070731	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT279526	hsa-miR-151a-3p	PAR-CLIP	21572407
MIRT070774	hsa-miR-4282	PAR-CLIP	21572407
MIRT070721	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT547981	hsa-miR-4499	PAR-CLIP	21572407
MIRT547980	hsa-miR-4463	PAR-CLIP	21572407
MIRT191510	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT070723	hsa-miR-3668	PAR-CLIP	21572407
MIRT070728	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT547979	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT547978	hsa-miR-217	PAR-CLIP	21572407
MIRT547977	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT191501	hsa-miR-3662	PAR-CLIP	21572407
MIRT398180	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547976	hsa-miR-4418	PAR-CLIP	21572407
MIRT547975	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT547974	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT536882	hsa-miR-1322	PAR-CLIP	21572407
MIRT191495	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	22012620
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	22012620
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	22012620
MIRT191501	hsa-miR-3662	PAR-CLIP	22012620
MIRT398180	hsa-miR-5692a	PAR-CLIP	22012620
MIRT536882	hsa-miR-1322	PAR-CLIP	22012620
MIRT191495	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	22012620
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	22012620
MIRT070750	hsa-miR-519d-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence, Flow cytometry	35959792
MIRT070742	hsa-miR-93-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37029581
MIRT755679	hsa-miR-4693-5p	Luciferase reporter assay, Western blotting, qRT-PCR	38668380
MIRT054349	hsa-miR-210-3p	Microarray, qRT-PCR	35816043
MIRT1045589	hsa-miR-106a	CLIP-seq
MIRT1045590	hsa-miR-106b	CLIP-seq
MIRT1045591	hsa-miR-1245b-3p	CLIP-seq
MIRT1045592	hsa-miR-1265	CLIP-seq
MIRT1045593	hsa-miR-1273c	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT1045595	hsa-miR-138	CLIP-seq
MIRT1045596	hsa-miR-17	CLIP-seq
MIRT1045597	hsa-miR-186	CLIP-seq
MIRT1045598	hsa-miR-194	CLIP-seq
MIRT1045599	hsa-miR-2053	CLIP-seq
MIRT1045600	hsa-miR-20a	CLIP-seq
MIRT1045601	hsa-miR-20b	CLIP-seq
MIRT1045602	hsa-miR-219-2-3p	CLIP-seq
MIRT1045603	hsa-miR-2964a-3p	CLIP-seq
MIRT1045604	hsa-miR-3120-5p	CLIP-seq
MIRT1045605	hsa-miR-3133	CLIP-seq
MIRT1045606	hsa-miR-3145-3p	CLIP-seq
MIRT1045607	hsa-miR-3152-3p	CLIP-seq
MIRT1045608	hsa-miR-3163	CLIP-seq
MIRT1045609	hsa-miR-3171	CLIP-seq
MIRT1045610	hsa-miR-338-5p	CLIP-seq
MIRT1045611	hsa-miR-340	CLIP-seq
MIRT1045612	hsa-miR-3591-5p	CLIP-seq
MIRT1045613	hsa-miR-3653	CLIP-seq
MIRT1045614	hsa-miR-3658	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT1045617	hsa-miR-3921	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT1045619	hsa-miR-4255	CLIP-seq
MIRT1045620	hsa-miR-4310	CLIP-seq
MIRT1045621	hsa-miR-4318	CLIP-seq
MIRT1045622	hsa-miR-4427	CLIP-seq
MIRT1045623	hsa-miR-4461	CLIP-seq
MIRT1045624	hsa-miR-4495	CLIP-seq
MIRT1045625	hsa-miR-4504	CLIP-seq
MIRT1045626	hsa-miR-4530	CLIP-seq
MIRT1045627	hsa-miR-4653-5p	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045629	hsa-miR-4668-3p	CLIP-seq
MIRT1045630	hsa-miR-4670-5p	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT1045632	hsa-miR-4677-3p	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT1045634	hsa-miR-4680-3p	CLIP-seq
MIRT755679	hsa-miR-4693-5p	CLIP-seq
MIRT1045635	hsa-miR-4699-3p	CLIP-seq
MIRT1045636	hsa-miR-4731-3p	CLIP-seq
MIRT1045637	hsa-miR-4768-5p	CLIP-seq
MIRT1045638	hsa-miR-4774-5p	CLIP-seq
MIRT1045639	hsa-miR-4801	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT1045641	hsa-miR-495	CLIP-seq
MIRT1045642	hsa-miR-519a	CLIP-seq
MIRT1045643	hsa-miR-519b-3p	CLIP-seq
MIRT1045644	hsa-miR-519d	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT1045647	hsa-miR-542-3p	CLIP-seq
MIRT1045648	hsa-miR-548ah	CLIP-seq
MIRT1045649	hsa-miR-548p	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT1045651	hsa-miR-562	CLIP-seq
MIRT1045652	hsa-miR-569	CLIP-seq
MIRT1045653	hsa-miR-580	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT1045655	hsa-miR-626	CLIP-seq
MIRT1045656	hsa-miR-633	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT1045658	hsa-miR-889	CLIP-seq
MIRT1045659	hsa-miR-892a	CLIP-seq
MIRT1045660	hsa-miR-93	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT1549495	hsa-miR-2682	CLIP-seq
MIRT1045607	hsa-miR-3152-3p	CLIP-seq
MIRT1045612	hsa-miR-3591-5p	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT1045619	hsa-miR-4255	CLIP-seq
MIRT1549496	hsa-miR-449c	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT1045649	hsa-miR-548p	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT1045658	hsa-miR-889	CLIP-seq
MIRT1045606	hsa-miR-3145-3p	CLIP-seq
MIRT1045610	hsa-miR-338-5p	CLIP-seq
MIRT1045613	hsa-miR-3653	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT1045621	hsa-miR-4318	CLIP-seq
MIRT1045625	hsa-miR-4504	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT755679	hsa-miR-4693-5p	CLIP-seq
MIRT1045635	hsa-miR-4699-3p	CLIP-seq
MIRT1045636	hsa-miR-4731-3p	CLIP-seq
MIRT1045639	hsa-miR-4801	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT1045647	hsa-miR-542-3p	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT1045658	hsa-miR-889	CLIP-seq
MIRT1045659	hsa-miR-892a	CLIP-seq
MIRT1045591	hsa-miR-1245b-3p	CLIP-seq
MIRT1549495	hsa-miR-2682	CLIP-seq
MIRT2242402	hsa-miR-3144-3p	CLIP-seq
MIRT1045607	hsa-miR-3152-3p	CLIP-seq
MIRT1045612	hsa-miR-3591-5p	CLIP-seq
MIRT1045613	hsa-miR-3653	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT2242403	hsa-miR-371b-5p	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT1045619	hsa-miR-4255	CLIP-seq
MIRT1549496	hsa-miR-449c	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT2242404	hsa-miR-4698	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT1045648	hsa-miR-548ah	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT2242405	hsa-miR-622	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT2242406	hsa-miR-767-3p	CLIP-seq
MIRT1045658	hsa-miR-889	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT2429567	hsa-miR-155	CLIP-seq
MIRT1045597	hsa-miR-186	CLIP-seq
MIRT2429568	hsa-miR-203	CLIP-seq
MIRT1045604	hsa-miR-3120-5p	CLIP-seq
MIRT1045605	hsa-miR-3133	CLIP-seq
MIRT2429569	hsa-miR-330-3p	CLIP-seq
MIRT1045613	hsa-miR-3653	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT2242403	hsa-miR-371b-5p	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT2429570	hsa-miR-4275	CLIP-seq
MIRT1045620	hsa-miR-4310	CLIP-seq
MIRT2429571	hsa-miR-4422	CLIP-seq
MIRT1045624	hsa-miR-4495	CLIP-seq
MIRT1045626	hsa-miR-4530	CLIP-seq
MIRT1045630	hsa-miR-4670-5p	CLIP-seq
MIRT1045632	hsa-miR-4677-3p	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT2242404	hsa-miR-4698	CLIP-seq
MIRT2429572	hsa-miR-4795-3p	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT2429573	hsa-miR-539	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT2429574	hsa-miR-556-5p	CLIP-seq
MIRT1045651	hsa-miR-562	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT2242405	hsa-miR-622	CLIP-seq
MIRT1045655	hsa-miR-626	CLIP-seq
MIRT1045656	hsa-miR-633	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT2242406	hsa-miR-767-3p	CLIP-seq
MIRT2429575	hsa-miR-888	CLIP-seq
MIRT2429576	hsa-miR-944	CLIP-seq
MIRT2429569	hsa-miR-330-3p	CLIP-seq
MIRT2429571	hsa-miR-4422	CLIP-seq
MIRT2429572	hsa-miR-4795-3p	CLIP-seq
MIRT1045589	hsa-miR-106a	CLIP-seq
MIRT1045590	hsa-miR-106b	CLIP-seq
MIRT1045591	hsa-miR-1245b-3p	CLIP-seq
MIRT2545962	hsa-miR-1248	CLIP-seq
MIRT1045592	hsa-miR-1265	CLIP-seq
MIRT1045593	hsa-miR-1273c	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT2429567	hsa-miR-155	CLIP-seq
MIRT1045596	hsa-miR-17	CLIP-seq
MIRT1045597	hsa-miR-186	CLIP-seq
MIRT2429568	hsa-miR-203	CLIP-seq
MIRT1045599	hsa-miR-2053	CLIP-seq
MIRT1045600	hsa-miR-20a	CLIP-seq
MIRT1045601	hsa-miR-20b	CLIP-seq
MIRT1045602	hsa-miR-219-2-3p	CLIP-seq
MIRT1549495	hsa-miR-2682	CLIP-seq
MIRT1045603	hsa-miR-2964a-3p	CLIP-seq
MIRT2545963	hsa-miR-3064-3p	CLIP-seq
MIRT1045604	hsa-miR-3120-5p	CLIP-seq
MIRT1045605	hsa-miR-3133	CLIP-seq
MIRT2545964	hsa-miR-3143	CLIP-seq
MIRT2242402	hsa-miR-3144-3p	CLIP-seq
MIRT1045608	hsa-miR-3163	CLIP-seq
MIRT1045610	hsa-miR-338-5p	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT2242403	hsa-miR-371b-5p	CLIP-seq
MIRT2545965	hsa-miR-376a	CLIP-seq
MIRT2545966	hsa-miR-376b	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT1045617	hsa-miR-3921	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT2429570	hsa-miR-4275	CLIP-seq
MIRT2545967	hsa-miR-4297	CLIP-seq
MIRT1045620	hsa-miR-4310	CLIP-seq
MIRT1045622	hsa-miR-4427	CLIP-seq
MIRT1045623	hsa-miR-4461	CLIP-seq
MIRT2545968	hsa-miR-448	CLIP-seq
MIRT1045624	hsa-miR-4495	CLIP-seq
MIRT1549496	hsa-miR-449c	CLIP-seq
MIRT1045626	hsa-miR-4530	CLIP-seq
MIRT2545969	hsa-miR-4639-5p	CLIP-seq
MIRT2545970	hsa-miR-4642	CLIP-seq
MIRT1045627	hsa-miR-4653-5p	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045629	hsa-miR-4668-3p	CLIP-seq
MIRT1045630	hsa-miR-4670-5p	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT1045632	hsa-miR-4677-3p	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT1045634	hsa-miR-4680-3p	CLIP-seq
MIRT2242404	hsa-miR-4698	CLIP-seq
MIRT2545971	hsa-miR-4717-5p	CLIP-seq
MIRT2545972	hsa-miR-4724-3p	CLIP-seq
MIRT1045636	hsa-miR-4731-3p	CLIP-seq
MIRT1045637	hsa-miR-4768-5p	CLIP-seq
MIRT2545973	hsa-miR-4777-5p	CLIP-seq
MIRT2545974	hsa-miR-4778-3p	CLIP-seq
MIRT1045639	hsa-miR-4801	CLIP-seq
MIRT2545975	hsa-miR-4803	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT2545976	hsa-miR-518d-5p	CLIP-seq
MIRT1045642	hsa-miR-519a	CLIP-seq
MIRT1045643	hsa-miR-519b-3p	CLIP-seq
MIRT2545977	hsa-miR-519b-5p	CLIP-seq
MIRT2545978	hsa-miR-519c-5p	CLIP-seq
MIRT1045644	hsa-miR-519d	CLIP-seq
MIRT2545979	hsa-miR-520c-5p	CLIP-seq
MIRT2545980	hsa-miR-520d-5p	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT2545981	hsa-miR-524-5p	CLIP-seq
MIRT2545982	hsa-miR-526a	CLIP-seq
MIRT2429573	hsa-miR-539	CLIP-seq
MIRT1045648	hsa-miR-548ah	CLIP-seq
MIRT2545983	hsa-miR-548c-3p	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT2429574	hsa-miR-556-5p	CLIP-seq
MIRT1045651	hsa-miR-562	CLIP-seq
MIRT1045652	hsa-miR-569	CLIP-seq
MIRT2545984	hsa-miR-578	CLIP-seq
MIRT1045653	hsa-miR-580	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT2545985	hsa-miR-586	CLIP-seq
MIRT2545986	hsa-miR-590-3p	CLIP-seq
MIRT2545987	hsa-miR-600	CLIP-seq
MIRT2242405	hsa-miR-622	CLIP-seq
MIRT1045655	hsa-miR-626	CLIP-seq
MIRT1045656	hsa-miR-633	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT2242406	hsa-miR-767-3p	CLIP-seq
MIRT2429575	hsa-miR-888	CLIP-seq
MIRT1045660	hsa-miR-93	CLIP-seq
MIRT2429576	hsa-miR-944	CLIP-seq
MIRT1045589	hsa-miR-106a	CLIP-seq
MIRT1045590	hsa-miR-106b	CLIP-seq
MIRT1045591	hsa-miR-1245b-3p	CLIP-seq
MIRT2545962	hsa-miR-1248	CLIP-seq
MIRT1045592	hsa-miR-1265	CLIP-seq
MIRT1045593	hsa-miR-1273c	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT2682296	hsa-miR-1305	CLIP-seq
MIRT2429567	hsa-miR-155	CLIP-seq
MIRT1045596	hsa-miR-17	CLIP-seq
MIRT1045597	hsa-miR-186	CLIP-seq
MIRT2429568	hsa-miR-203	CLIP-seq
MIRT1045599	hsa-miR-2053	CLIP-seq
MIRT1045600	hsa-miR-20a	CLIP-seq
MIRT1045601	hsa-miR-20b	CLIP-seq
MIRT1045602	hsa-miR-219-2-3p	CLIP-seq
MIRT1549495	hsa-miR-2682	CLIP-seq
MIRT1045603	hsa-miR-2964a-3p	CLIP-seq
MIRT2545963	hsa-miR-3064-3p	CLIP-seq
MIRT1045604	hsa-miR-3120-5p	CLIP-seq
MIRT1045605	hsa-miR-3133	CLIP-seq
MIRT2545964	hsa-miR-3143	CLIP-seq
MIRT2242402	hsa-miR-3144-3p	CLIP-seq
MIRT1045608	hsa-miR-3163	CLIP-seq
MIRT2429569	hsa-miR-330-3p	CLIP-seq
MIRT1045610	hsa-miR-338-5p	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT2242403	hsa-miR-371b-5p	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT2682297	hsa-miR-380	CLIP-seq
MIRT1045617	hsa-miR-3921	CLIP-seq
MIRT2682298	hsa-miR-3924	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT2429570	hsa-miR-4275	CLIP-seq
MIRT2545967	hsa-miR-4297	CLIP-seq
MIRT1045620	hsa-miR-4310	CLIP-seq
MIRT2429571	hsa-miR-4422	CLIP-seq
MIRT1045622	hsa-miR-4427	CLIP-seq
MIRT1045623	hsa-miR-4461	CLIP-seq
MIRT2545968	hsa-miR-448	CLIP-seq
MIRT1045624	hsa-miR-4495	CLIP-seq
MIRT1549496	hsa-miR-449c	CLIP-seq
MIRT1045626	hsa-miR-4530	CLIP-seq
MIRT2545969	hsa-miR-4639-5p	CLIP-seq
MIRT2545970	hsa-miR-4642	CLIP-seq
MIRT1045627	hsa-miR-4653-5p	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045629	hsa-miR-4668-3p	CLIP-seq
MIRT1045630	hsa-miR-4670-5p	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT1045632	hsa-miR-4677-3p	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT1045634	hsa-miR-4680-3p	CLIP-seq
MIRT2242404	hsa-miR-4698	CLIP-seq
MIRT2545972	hsa-miR-4724-3p	CLIP-seq
MIRT1045636	hsa-miR-4731-3p	CLIP-seq
MIRT1045637	hsa-miR-4768-5p	CLIP-seq
MIRT2545973	hsa-miR-4777-5p	CLIP-seq
MIRT2545974	hsa-miR-4778-3p	CLIP-seq
MIRT2429572	hsa-miR-4795-3p	CLIP-seq
MIRT1045639	hsa-miR-4801	CLIP-seq
MIRT2545975	hsa-miR-4803	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT2545976	hsa-miR-518d-5p	CLIP-seq
MIRT1045642	hsa-miR-519a	CLIP-seq
MIRT1045643	hsa-miR-519b-3p	CLIP-seq
MIRT2545977	hsa-miR-519b-5p	CLIP-seq
MIRT2545978	hsa-miR-519c-5p	CLIP-seq
MIRT1045644	hsa-miR-519d	CLIP-seq
MIRT2545979	hsa-miR-520c-5p	CLIP-seq
MIRT2545980	hsa-miR-520d-5p	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT2545981	hsa-miR-524-5p	CLIP-seq
MIRT2545982	hsa-miR-526a	CLIP-seq
MIRT2429573	hsa-miR-539	CLIP-seq
MIRT1045648	hsa-miR-548ah	CLIP-seq
MIRT2545983	hsa-miR-548c-3p	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT2429574	hsa-miR-556-5p	CLIP-seq
MIRT1045651	hsa-miR-562	CLIP-seq
MIRT1045652	hsa-miR-569	CLIP-seq
MIRT2545984	hsa-miR-578	CLIP-seq
MIRT1045653	hsa-miR-580	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT2545985	hsa-miR-586	CLIP-seq
MIRT2545986	hsa-miR-590-3p	CLIP-seq
MIRT2545987	hsa-miR-600	CLIP-seq
MIRT2242405	hsa-miR-622	CLIP-seq
MIRT1045655	hsa-miR-626	CLIP-seq
MIRT1045656	hsa-miR-633	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT2242406	hsa-miR-767-3p	CLIP-seq
MIRT2429575	hsa-miR-888	CLIP-seq
MIRT1045660	hsa-miR-93	CLIP-seq
MIRT2429576	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARNT	Activation	14764593
BRCA1	Unknown	16543242
EGR1	Activation	18506761
FOXO4	Repression	12761217;20136501
HDAC7	Activation	20693714
HDAC7	Repression	22172637
HIF1A	Repression	14744852
HIF3A	Unknown	19755485
HIPK2	Repression	19046997
HSF2	Unknown	21258402
HSF4	Unknown	21258402
KLF5	Activation	23880760
LIMD1	Repression	22286099
MITF	Activation	22012259
NFKB1	Unknown	18498249
NFKB2	Repression	19414801
RELA	Unknown	18498249
SIRT1	Activation	22245592
STAT3	Activation	17597020;18644974;19265129
STAT3	Unknown	23991099
USF2	Unknown	23991099
VHL	Repression	11987242
VHL	Unknown	11727931;19238077
YY1	Unknown	20660740
ZFP36	Activation	19962963
ZFP36	Repression	19962963

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IDA	32697943
GO:0000785	Component	Chromatin	IDA	19782034
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19782034
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	33108349
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	7539918, 8756616
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	8387214, 9079689
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IMP	31368162
GO:0001216	Function	DNA-binding transcription activator activity	IMP	33108349
GO:0001217	Function	DNA-binding transcription repressor activity	IMP	31368162
GO:0001222	Function	Transcription corepressor binding	IPI	19071119
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001223	Function	Transcription coactivator binding	IPI	15261140, 19071119
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19071119, 19782034
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	24983504
GO:0001525	Process	Angiogenesis	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001666	Process	Response to hypoxia	IDA	11782478
GO:0001666	Process	Response to hypoxia	IDA	8756616, 9887100, 15261140, 18419598
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	IMP	12411310
GO:0001678	Process	Intracellular glucose homeostasis	IDA	30125331
GO:0001755	Process	Neural crest cell migration	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS	18037992
GO:0001892	Process	Embryonic placenta development	IEA
GO:0001922	Process	B-1 B cell homeostasis	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IC	8756616
GO:0001944	Process	Vasculature development	IEA
GO:0001947	Process	Heart looping	IEA
GO:0002039	Function	P53 binding	EXP	15629713
GO:0002039	Function	P53 binding	IDA	15629713
GO:0002039	Function	P53 binding	IPI	15629713
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0002067	Process	Glandular epithelial cell differentiation	IEA
GO:0002071	Process	Glandular epithelial cell maturation	IEA
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	IEA
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	ISS	18037992
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003208	Process	Cardiac ventricle morphogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11782478, 15261140, 18658046, 25043030, 30125331
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	9704006, 9887100, 11292862, 11959977, 12004076, 12050673, 12446723, 14668441, 15261140, 15721254, 16126907, 16189514, 16424018, 16511565, 16543236, 17003112, 17024177, 17353276, 17382325, 17426252, 18268343, 18323857, 18427106, 18509053, 18775313, 19071119, 19680224, 20562859, 20603
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8089148, 15261140, 18658046, 20810912, 20972335, 22848707, 24048733, 25043030
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005737	Component	Cytoplasm	IDA	19651758, 24048733
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	24681946
GO:0005829	Component	Cytosol	TAS
GO:0006089	Process	Lactate metabolic process	IEA
GO:0006110	Process	Regulation of glycolytic process	IDA	32697943
GO:0006110	Process	Regulation of glycolytic process	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	11782478
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15261140
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IMP	12411310
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007595	Process	Lactation	IEA
GO:0008542	Process	Visual learning	IEA
GO:0010039	Process	Response to iron ion	IEP	28296633
GO:0010468	Process	Regulation of gene expression	IDA	18419598, 32697943
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12958148
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IDA	8756616
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	18658046
GO:0010628	Process	Positive regulation of gene expression	IDA	15459207
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	21817107, 22886504
GO:0010629	Process	Negative regulation of gene expression	IMP	26879375
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	ISS	18037992
GO:0014850	Process	Response to muscle activity	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0016607	Component	Nuclear speck	ISS
GO:0016922	Function	Nuclear receptor binding	IPI	18658046
GO:0019896	Process	Axonal transport of mitochondrion	IMP	19528298
GO:0019899	Function	Enzyme binding	IPI	11641274
GO:0019901	Function	Protein kinase binding	IPI	20889502
GO:0019904	Function	Protein domain specific binding	IPI	14594809
GO:0021502	Process	Neural fold elevation formation	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030282	Process	Bone mineralization	IEA
GO:0030502	Process	Negative regulation of bone mineralization	IEA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IC	8756616, 12958148
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	EXP	12004076, 12050673
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11641274, 12050673
GO:0031929	Process	TOR signaling	IEA
GO:0032007	Process	Negative regulation of TOR signaling	IEA
GO:0032364	Process	Intracellular oxygen homeostasis	IBA
GO:0032364	Process	Intracellular oxygen homeostasis	IDA	16956324
GO:0032364	Process	Intracellular oxygen homeostasis	IEA
GO:0032722	Process	Positive regulation of chemokine production	TAS	18370914
GO:0032909	Process	Regulation of transforming growth factor beta2 production	IMP	12411310
GO:0032963	Process	Collagen metabolic process	IEA
GO:0032963	Process	Collagen metabolic process	ISS	18037992
GO:0032991	Component	Protein-containing complex	IMP	14594809, 15629713
GO:0034599	Process	Cellular response to oxidative stress	IDA	8089148, 8387214
GO:0035162	Process	Embryonic hemopoiesis	IEA
GO:0035773	Process	Insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042541	Process	Hemoglobin biosynthetic process	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	19071119
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	26879375
GO:0043565	Function	Sequence-specific DNA binding	IDA	7539918, 8756616, 9079689
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IC	1448077
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IC	8756616
GO:0045766	Process	Positive regulation of angiogenesis	IMP	24048733, 26879375
GO:0045821	Process	Positive regulation of glycolytic process	IDA	8089148
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9887100, 25043030
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	21056661
GO:0045926	Process	Negative regulation of growth	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7539918, 8089148, 8387214, 11573933, 19071119, 22735262, 32697943
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	17981124
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19652095, 24048733, 24681946
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0046886	Process	Positive regulation of hormone biosynthetic process	IDA	1448077
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	9079689, 12239177
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048593	Process	Camera-type eye morphogenesis	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051541	Process	Elastin metabolic process	IEA
GO:0051541	Process	Elastin metabolic process	ISS	18037992
GO:0051879	Function	Hsp90 protein binding	IDA	9079689
GO:0060574	Process	Intestinal epithelial cell maturation	IEA
GO:0061030	Process	Epithelial cell differentiation involved in mammary gland alveolus development	IEA
GO:0061072	Process	Iris morphogenesis	IEA
GO:0061298	Process	Retina vasculature development in camera-type eye	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	7539918
GO:0070101	Process	Positive regulation of chemokine-mediated signaling pathway	IDA	17178876
GO:0070243	Process	Regulation of thymocyte apoptotic process	IEA
GO:0070244	Process	Negative regulation of thymocyte apoptotic process	IEA
GO:0070888	Function	E-box binding	IEA
GO:0071347	Process	Cellular response to interleukin-1	IDA	12958148
GO:0071456	Process	Cellular response to hypoxia	IBA
GO:0071456	Process	Cellular response to hypoxia	IDA	11573933, 19528298, 20889502, 22735262
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071456	Process	Cellular response to hypoxia	IEP	19782034, 20810912
GO:0071456	Process	Cellular response to hypoxia	IMP	19652095, 24681946
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	7539918, 8756616
GO:0097152	Process	Mesenchymal cell apoptotic process	IEA
GO:0097411	Process	Hypoxia-inducible factor-1alpha signaling pathway	IEA
GO:0098586	Process	Cellular response to virus	IDA	32697943
GO:0140537	Function	Transcription regulator activator activity	IPI	11063749
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	32697943
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	31368162
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	19782034, 24244340
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IMP	19141645, 24983504, 33108349
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	24899725
GO:1904115	Component	Axon cytoplasm	IEA
GO:1904407	Process	Positive regulation of nitric oxide metabolic process	TAS	18254728
GO:2000434	Process	Regulation of protein neddylation	IEA
GO:2000434	Process	Regulation of protein neddylation	IMP	23401859
GO:2001054	Process	Negative regulation of mesenchymal cell apoptotic process	IEA

Other IDs

• MIM: 603348
• HGNC: 4910
• e!Ensembl: ENSG00000100644

Protein

• UniProt ID: Q16665
• Protein name: Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)
• Protein function: Functions as a master transcriptional regulator of the adaptive response to hypoxia (PubMed:11292861, PubMed:11566883, PubMed:15465032, PubMed:16973622, PubMed:17610843, PubMed:18658046, PubMed:20624928, PubMed:22009797, PubMed:30125331, PubMed:
• PDB: 1H2K, 1H2L, 1H2M, 1L3E, 1L8C, 1LM8, 1LQB, 2ILM, 3HQR, 3HQU, 4AJY, 4H6J, 5JWP, 5L9B, 5L9V, 5LA9, 5LAS, 6GFX, 6GMR, 6YW3, 7LVS, 7QGS, 8HE0, 8HE3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00989	PAS	90 → 188	PAS fold	Domain
  PF08447	PAS_3	252 → 339	PAS fold	Domain
  PF11413	HIF-1	551 → 581	Hypoxia-inducible factor-1	Family
  PF08778	HIF-1a_CTAD	789 → 825	HIF-1 alpha C terminal transactivation domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding o
• Sequence:

  MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
  RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
  GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
  TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
  TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
  TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
  LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
  DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
  NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
  AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
  VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
  DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
  KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
  RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

• Sequence length: 826

Pathways

KEGG:

HIF-1 signaling pathway
Mitophagy - animal
Autophagy - animal
Efferocytosis
Th17 cell differentiation
Thyroid hormone signaling pathway
Kaposi sarcoma-associated herpesvirus infection
Pathways in cancer
Proteoglycans in cancer
Chemical carcinogenesis - reactive oxygen species
Renal cell carcinoma
Central carbon metabolism in cancer
Choline metabolism in cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer

Reactome:

Regulation of gene expression by Hypoxia-inducible Factor
Cellular response to hypoxia
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Ub-specific processing proteases
Interleukin-4 and Interleukin-13 signaling
PTK6 Expression
PTK6 promotes HIF1A stabilization
Neddylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Enchondromatosis	Likely pathogenic	rs2503132758, rs199752292, rs2503156139	RCV002468425 RCV002468427 RCV002468429	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Maffucci syndrome	Likely pathogenic	rs2044704486, rs2503149952	RCV002468428 RCV002468430	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANAPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, INTRADUCTAL, NONINFILTRATING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLANGITIS, SCLEROSING	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLICATIONS OF DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES COMPLICATIONS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	31800874		★☆☆☆☆ Found in Text Mining only
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	20832699, 21242666, 25431923, 30278484, 31461385		★☆☆☆☆ Found in Text Mining only
Acidosis Lactic	Lactic acidosis	Pubtator	22135092	Inhibit	★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24966925, 27002764		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27002764		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	21868571, 24064771, 26642852, 30595549		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29409830		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24711541, 25931453, 30909668		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	25248926		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12209691, 12632503, 17452775, 17487356		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15498380, 15709164, 17201171, 18026974, 18292935, 18592007, 18704463, 18704599, 20489156, 21415706, 28062918, 30306561, 31077234		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	20429620, 21993963		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15498380, 20514449, 21628883, 31101574		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11751212, 17335808, 17376295, 17560552, 19735869, 20347035, 21333376, 22248028, 23246962, 23549264, 24452130, 25959252, 27588392, 30121641, 30665327, 30696468, 30800222, 31410024		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	17210698, 19352387, 20556833, 23857671, 29396728		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	19211554, 21037926, 29137361		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	20117921		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	LHGDN	19121088		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25485635, 28179306, 30746817, 30945361		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15498380, 18026974, 18351386, 18704463, 30733705		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18351386		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15498380, 18351386		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	20844082		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21415706		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	16954163, 17520677, 19228690, 19671538, 20980436, 23889685, 24676840, 28979191		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	29803899		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27002764		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	21176961		★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	24608455		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23020605		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26984380		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28558056, 29543881		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20827750, 23082872, 28302031, 30320358		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	17947829, 19589398, 24995509, 27599360, 28220790, 30103950, 31695081, 31743875		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	24510998, 26323347, 28179306		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21625490, 24717944		★☆☆☆☆ Found in Text Mining only
ALPHA-THALASSEMIA/MENTAL RETARDATION SYNDROME, NONDELETION TYPE, X-LINKED	alpha-Thalassemia Mental Retardation Syndrome, X-Linked	BEFREE	29846902		★☆☆☆☆ Found in Text Mining only
Alveolar capillary dysplasia	Alveolar capillary dysplasia	Pubtator	35649494	Stimulate	★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	21552147		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26228060, 31291905, 32341353, 32980851, 36035305, 39518952	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	31674718		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	33067558	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23368766, 30918303, 31344397		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	18704599, 28427209, 28446589, 28801626, 29891662		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplasia	Anaplasia	CTD_human_DG	19808899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	12060345, 22825389		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	19808899		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	16826581, 34617686	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	21976486, 22571903, 22846720, 23264599, 24120591, 24297864, 24760996, 28881642, 30387200, 30772502		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	24120591	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	21175428, 32352161	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	20952681, 21175428, 23125209, 25876995		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	30332653	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	35069552	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	24089028, 36435742	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	24089028	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	15331549, 18842422		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	32198016	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31401905		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	34421088	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21709439, 22899799, 23485726, 24599125, 24662981, 25314054, 25385028, 25799412, 26715642, 26872370, 26976451, 27623078, 29038348, 29396728, 29758199, 29973215, 30078003, 30214007, 30679163, 30867721, 30922919, 31076568, 31119050, 31239153		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	31295466		★☆☆☆☆ Found in Text Mining only
Anoxia-Ischemia, Brain	Anorexia	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Anoxia-Ischemia, Cerebral	Anorexia	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Anoxic-Ischemic Encephalopathy	Anoxic-Ischemic Encephalopathy	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	25550800, 26062299, 28302917		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24657063, 29191809, 35055064	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	25550800	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	37801489	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	20938207, 24657063, 27363580, 28196857, 29191809, 29242064, 31085912		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracoabdominal	Aortic Aneurysm	BEFREE	26062299		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	25550800, 26339353, 28415624	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	30602302		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	26497365, 27196763		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	24510998, 26323347, 28179306		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	31375661	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17343848, 19834107, 24657063, 26404487, 26483345, 27363580, 28882872, 28942242, 29920371, 30386909		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30030103		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	18512817	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12384916, 12823854, 20353560, 22488178, 26604208, 28067317, 33362761, 34385542, 34877935, 35690741, 35720293, 38166916, 40190499	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23967327, 34588517	Stimulate	★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	25340332		★☆☆☆☆ Found in Text Mining only
Asphyxia	Asphyxia	Pubtator	34067945	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	30222022		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	30222022	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21517900, 24717944, 28093362, 29031476, 30150897, 30660639, 31430856, 31647966		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31430856	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12456339, 15175080, 15459006, 16724682, 22825389, 24599602, 24970694, 25790191, 28006727, 30569180		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	LHGDN	15175080		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	CTD_human_DG	15341671		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	16724682, 25790191	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23085754		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12586627, 20719466, 33299319, 35069552	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17343848, 19834107, 24657063, 26404487, 26483345, 27363580, 28882872, 28942242, 29920371, 30386909		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20631454, 31473195		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	20631454	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36226239	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	25700369	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	CTD_human_DG	20526721		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28553732, 29306019, 29343683, 30043119		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37558878	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25661370, 26323347, 28123543, 28586054, 30252847, 30808828, 31203382, 31632589		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	17437013		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	19014607		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19096962, 22986049, 31734054		★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	15084243, 24567056	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	26510548		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	36150932	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	22271822		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	22271822		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	25446376	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11350893, 15821583, 18000826, 24584933, 24737584, 25266796, 25824695, 26541358, 26717965, 27181362, 27196763, 27557492, 28710377, 29267502, 29317342, 29467870, 29693166, 30026847, 30241031, 30315244		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16142350		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	20857420		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	26598923, 37801489	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	29645000		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	18588890, 19525194		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	LHGDN	18588890		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	26460121, 36134117, 36147560, 36967561	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	25401740		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	33921064	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	18283716, 30782196		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	28097375	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	23333658		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	12764056	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	23877362, 32908869	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Brain injuries	Pubtator	37239335	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	15770733, 17511040, 23770788, 27951596, 36150932	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	19429140		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	24201448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	15175080, 20819065, 23082872, 24366912, 29097800, 31106146		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	18621534		★☆☆☆☆ Found in Text Mining only
Brain Stem Glioma	Brain Stem Glioma	BEFREE	29937714		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	17998062, 21628883, 26480821		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	23326384		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12208766, 12242695, 12402159, 14580258, 15217513, 15280403, 15623945, 16585198, 16924239, 16954428, 17140257, 17483326, 17957335, 18030615, 18072750, 18160046, 18292935, 18316553, 18949419, 19212630, 19231068, 19307182, 19390242, 19580347, 19766100, 20035632, 20307196, 20442288, 20526721, 20624301, 20680678, 20682797, 20727020, 21036805, 21069452, 21233846, 21266576, 21266827, 21291529, 21338575, 21496870, 21514280, 21877141, 21897387, 21911388, 22043993, 22320863, 22875853, 22894905, 23065205, 23129632, 23409769, 23423382, 23566437, 23667251, 23696831, 23728336, 23749907, 23832257, 23869589, 23870899, 23925655, 23947803, 24349381, 24472707, 24648344, 24659092, 24737252, 25069832, 25270118, 25334080, 25447306, 25453096, 25484025, 25496056, 25510668, 25520138, 25535357, 25556440, 25579062, 25587023, 25596742, 25874499, 25920936, 25976207, 26046764, 26158266, 26174737, 26196741, 26229077, 26239613, 26287601, 26339588, 26512116, 26520789, 26598706, 26598923, 26648580, 26718330, 26745120, 26921175, 27105516, 27184798, 27185877, 27303043, 27325313, 27497816, 27590511, 27805252, 27862063, 27902314, 28039264, 28089831, 28239645, 28320353, 28351619, 28401339, 28485159, 28529559, 28559303, 28574600, 28739726, 28747336, 28927155, 29053417, 29180628, 29254140, 29275212, 29283324, 29367761, 29391899, 29393454, 29599405, 29629903, 29725006, 29880481, 29913554, 29976963, 29996493, 30135144, 30157616, 30275854, 30537744, 30538116, 30572455, 30609375, 30635931, 30774370, 30930227, 30930461, 30936474, 30940798, 30943919, 31062127, 31078780, 31254605, 31359335, 31481238, 31529195, 31554283, 31577739, 31705798, 31750963, 31773719, 31821370		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	24349381		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12627523, 15084243, 15217513, 15677538, 15967109, 16168127, 16543242, 16847054, 16899602, 17140257, 17224643, 17332506, 17426247, 17597020, 18096060, 19091749, 19291283, 19307182, 19349962, 19390242, 19569175, 19919679, 20151982, 20164027, 20509143, 20624301, 20624302, 20626868, 20682797, 21291529, 21732131, 21824412, 21890452, 21897387, 21911388, 21915477, 21930697, 21980400, 22435731, 22894905, 22937154, 23012449, 23314174, 23326384, 23372804, 23409121, 23423382, 23549681, 23566437, 23631762, 23667251, 23696831, 23840849, 23869589, 24171172, 24732598, 24838727, 24965403, 25128202, 25333258, 25453096, 25510668, 25556440, 25596742, 26059435, 26079208, 26339353, 26372732, 26512116, 26512778, 26520789, 26598706, 26598923, 26696754, 26745120, 26760782, 26825173, 26841847, 27001847, 27105516, 27185877, 27303043, 27325313, 27629849, 28038470, 28198519, 28739726, 29212519, 30135144, 30241031, 30270262, 30420728, 30537744, 30572455, 30876462, 30930461, 30934018, 30939201, 30943919, 31078780, 31462898, 31486323, 31577739, 31740625, 31821370, 32212787, 32436609, 32593213, 33292020, 33374849, 33888756, 34158854, 34365889, 34502189, 34592152, 34620747, 34706936, 34736510, 34933912, 34940128, 35008634, 35140341, 35309179, 35753261, 35796020, 35853854, 36077517, 36080483, 36335375, 36473847, 36641657, 36892943, 37209192, 37768037, 38012382, 38158708, 38478356, 39307606, 39913285, 40320538, 40598910	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	22684218	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	21606603, 30696477		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	23333658, 28381639		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	20066420		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	26312753, 31560931		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26312753	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	31560931	Stimulate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	28474313, 31034990	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	24293391		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	33000216, 35265311	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12070140, 12213806, 12387890, 15082527, 16080559, 16884534, 17179985, 17452774, 18493321, 18983642, 19359588, 20596845, 20829524, 21156006, 21778301, 22144179, 22186139, 23604114, 23671581, 24436242, 24732040, 25377659, 26547841, 26743088, 26846782, 28169245, 28638274, 29587825, 30535970, 31963541, 32326742, 32945470, 33682749, 35292059, 35440019, 35860430, 36091021	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22355351, 23977378	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	21557221	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11431362, 11454426, 11804750, 14507651, 16489060, 16847924, 17555795, 17984117, 18351386, 19250857, 20213325, 20624301, 24629239, 25915846, 30220031, 30950543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	19808899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	29085834	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25485635, 26323347, 32386517	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25997612	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21672245	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	25181405	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	16080559, 21824412, 23409121	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	27303043	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	17452774, 20565904	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15786555, 18651980, 19286567, 19948069, 20924210, 21332301, 21840307, 22178269, 23496980, 23792163, 23852087, 23958427, 23966163, 24346287, 24590895, 24840636, 24895585, 25169545, 25323032, 25596085, 26078356, 26115041, 26612965, 26783726, 26884855, 26910835, 26984380, 27173353, 27249600, 27807254, 28449718, 28485808, 28653891, 28810896, 28886081, 28894087, 29028096, 29237157, 29285854, 29748591, 29881400, 29970668, 30180863, 30258464, 30917505, 31578577, 31828143, 31931758, 32062551, 32084009, 32473641, 32772041, 33128030, 33246501, 33290263, 33294448, 33327261, 33436534, 33673041, 34609072, 34903711, 34912753, 35013529, 35140333, 35244188, 35283421, 35429130, 35546067, 35764883, 35768071, 36071871, 36098205, 36157928, 36578460, 36588357, 36632750, 37087978, 37248280, 37490813, 37501379, 38013127, 39346898	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	23409121, 32980776	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11350893, 15821583, 18000826, 24584933, 24737584, 25266796, 25824695, 26541358, 26717965, 27181362, 27196763, 27557492, 28263974, 28710377, 29267502, 29317342, 29467870, 29693166, 30026847, 30315244		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	23087365, 25412955, 28410229, 28878571		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12593853, 16397226, 17335808, 18239067, 18292935, 19176399, 19305150, 20885442, 21435097, 21666710, 21812995, 21965273, 22153809, 22349311, 22467238, 23275310, 23526365, 24008975, 24403227, 24793809, 24824937, 25748238, 26002230, 26508030, 26528854, 26548300, 27423680, 28028936, 28259980, 28339070, 28423489, 28537679, 28610954, 28838387, 29207023, 29393397, 29616117, 29891977, 29904944, 30015910, 30128035, 30250643, 30338933, 30539834, 30617444, 30628067, 30634531, 30665327, 30816548, 31004547, 31061665, 31221150, 31656668, 31802910, 31839825		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	24457463		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20831794, 21620448, 23202951, 23545606, 27044634, 28091613, 36814597	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29770329	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18592007, 20556833, 21709439, 25542265, 26872370, 29973215, 30214007, 32185224, 34036383, 34925373, 34933912, 35650603, 36291742, 36912618	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28475017	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	12110091, 15220362, 15967109, 16205110, 17387348, 17482131, 17699105, 18547492, 19061835, 19077470, 19252820, 19302703, 19401348, 20032376, 20175781, 20185829, 20679884, 21057536, 21209004, 21281817, 21332301, 21386837, 21602888, 21725288, 21778301, 21875287, 21949677, 22094876, 22286234, 22367210, 22517515, 22614155, 23150176, 23159849, 23185271, 23335244, 23881929, 24086736, 24294381, 24625422, 24916699, 25093297, 25100134, 26262842, 26544728, 26937175, 27029070, 27128972, 27244898, 27583351, 27834463, 27836247, 28492542, 28572533, 28951244, 29357946, 30144808, 30824757, 30909494, 31268155, 31427440, 31924838, 32194829, 32250548, 32586940, 33077781, 34135317, 34218253, 34353313, 34433833, 34624550, 34870494, 35937460, 36097192, 37024613, 37045834, 37103094, 38273861, 40332447	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17505508	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33118406	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	24980293	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16053510, 21598042, 24436242, 26985936, 29109451, 33621198, 33723932, 36187110, 37347115, 38581999	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17201171, 23295589, 37445752	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	23840849, 25181405, 27601172		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	16510175, 17532031		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	29068435, 29763721		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11410504, 11804750, 15297183, 17498666, 17532031, 18476949, 19014607, 19016748, 20140681, 20398289, 21701041, 23389731, 23545606, 25174950, 25491408, 25756515, 25975373, 26548925, 26801746, 26909598, 27044634, 28091613, 28401704, 28459376, 28878214, 29797601, 30867818, 30912527, 31059002, 31077234, 31175269, 31437208, 31587013, 31639424, 31700155, 31851935		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	20587661		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	19808899		★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	20846364		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	15805230, 24444256, 25884818, 36435742	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	22258630, 22302938, 29027966		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	24444256	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	30338905, 39523983	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20526721, 25822459, 28401339, 29695771		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17720748, 19602906, 22105711, 26254226, 27903434, 29753320		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27450023, 33299319, 35069552, 35908957	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	20498255		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	15987493, 18050215, 22736200, 30255592	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	25088997		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	20453713, 29209126		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27701053	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Cerebral Hypoxia-Ischemia	Cerebral Hypoxia-Ischemia	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19394379, 25270619, 27896629, 28382159, 28566998, 28685721, 29228704, 31679265		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	34708885	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	40629591	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	14526383, 16842166, 21293012, 23702312, 25972164, 27780722, 27801527, 28320188, 29336875, 29478025, 29649974, 29890157, 30052311, 30233326, 30733705		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	31297056		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19574782, 20206160, 20627616, 21330825, 22925504, 23375385, 24195510, 25337255, 25905434, 26718775, 27593081, 29207048, 29654110, 30355300, 30530968, 31452725		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	18055005, 23375385, 29654110		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19574782, 20206160, 20627616, 21330825, 21887463, 21887475, 22925504, 23375385, 24195510, 25337255, 25905434, 26718775, 27593081, 29109775, 29207048, 29654110, 30355300, 30648775, 31452725		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15014526, 24160851, 27002764		★☆☆☆☆ Found in Text Mining only
Childhood Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26984380		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28558056, 29543881		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20827750, 23082872, 28302031, 30320358		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16094703, 25081716, 26056085, 29953500, 35683032, 37781039, 37821935	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23339102, 29953500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis, Sclerosing	Cholangitis	CTD_human_DG	22271822		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholecystitis Acute	Cholecystitis	Pubtator	17974017	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	28088462		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	28088462		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	34522167	Associate	★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	28088462		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	15475194, 20102637, 20459575, 22761648, 23584483, 25106798, 30605014		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	15475194		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	15475194, 20102637, 20661931, 32469486	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	21143841		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	21143841	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	26037477, 26094772, 30478339		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	26882120, 37598400	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	21057536		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	24703425		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23481058, 24703425, 25692954, 27503806, 28331062, 28537846, 28820398, 28947737, 30387200, 31526861, 31588798, 31623681, 31691948		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19336759, 22841548, 26825709, 28038356, 31289209, 31823704		★☆☆☆☆ Found in Text Mining only
Chronic mountain sickness	Mountain sickness	BEFREE	12614929, 18578644		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	27341002, 28554272, 31728053		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21544845, 21651746, 25565795, 26752192, 26782374, 28865600, 29328439, 29339421, 29692824, 29765317, 30250643, 30280794, 30542404, 30575333, 31663668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	31757417		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28102059, 31635898, 31785303		★☆☆☆☆ Found in Text Mining only
Chuvash erythrocytosis	Chuvash Erythrocytosis	BEFREE	11987242, 20140661, 21389259, 21993671		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21557766, 24057240, 30274686		★☆☆☆☆ Found in Text Mining only
Clear cell papillary renal cell carcinoma	Papillary Renal Carcinoma	BEFREE	24294381		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	12853836, 20679884, 25715653, 27128972, 27358011, 27663598		★☆☆☆☆ Found in Text Mining only
Clubfoot	Clubfoot	Pubtator	35292718	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type II	Cockayne Syndrome	BEFREE	31499711		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28887194		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	15489957, 22108053, 22457366, 26183215, 27076683, 27921309, 28282584, 28740109, 29261815, 29967068, 30430451, 31241981		★☆☆☆☆ Found in Text Mining only
Colitis Ischemic	Colitis	Pubtator	15770733	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12610101, 33432986, 33634990, 36461588	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14996738, 16127434, 16543245, 16701010, 17431122, 17488804, 18365547, 19435875, 19843849, 20217131, 20407014, 20429620, 20514449, 20599784, 20691219, 21629773, 21660559, 21748762, 22948784, 23880760, 24629239, 24718784, 24901645, 25316231, 25978030, 25979228, 26183215, 26503233, 26882567, 26996300, 27144516, 27543779, 27573201, 27793037, 28061476, 28341244, 28486050, 28864720, 28936522, 29467884, 29630948, 30357530, 30746305, 30885992, 31420015, 31849679		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12016145, 12727858, 16543245, 18365547, 19030186		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12632503, 16294025, 18936210, 20217131, 24901645, 35902970, 36246978	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19843849, 27982118, 30339780		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12673675, 15492789, 15498380, 16819509, 16865676, 16937436, 17591803, 18023174, 18704463, 20429620, 20514449, 20525878, 20572162, 20635169, 20651398, 21378341, 22852817, 22948784, 23060299, 23348791, 23640464, 23748663, 23811286, 23838996, 23970287, 24497137, 24612059, 24629239, 24825851, 24861206, 24969897, 25453050, 25602156, 26057751, 26065676, 26116902, 26214618, 26339356, 26730155, 26735579, 26856989, 26938486, 27121066, 27421843, 27671226, 27742687, 27840318, 27869227, 27966538, 28169245, 28199842, 28478181, 28554753, 28594405, 28628187, 28757355, 28759037, 28899657, 28912885, 28928094, 29075793, 29435158, 29848680, 29886834, 29891662, 29910683, 30038060, 30121667, 30357530, 30393198, 30410397, 30542494, 30669593, 30737895, 30756254, 30779072, 30834693, 31201065, 31208913, 31291975, 31477841, 31775562		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12632503, 14965365, 16937436, 17016487, 17387384, 17591803, 18351386, 18648372, 19298255, 19540709, 19619276, 19843849, 19898961, 20003271, 20407014, 20442290, 20953377, 21073737, 21576240, 21629773, 21791631, 22872060, 23071744, 23640464, 23880760, 24497137, 24629239, 24634093, 24804733, 24901645, 24932611, 24969897, 25396735, 25409929, 25605240, 25644309, 25717256, 26219897, 26320510, 26339356, 26379394, 26730155, 27121066, 27604859, 27974949, 28169245, 28214471, 28486050, 29278853, 29749460, 29884183, 29891662, 29910683, 30121667, 30669593, 30834693, 31291975, 32037723, 32092829, 32143722, 32152662, 32323837, 32644049, 32655498, 33029691, 34237211, 34775260, 34969360, 35186110, 35440019, 35543151, 35739524, 36347835, 36915998, 37816999, 38175205, 38270125, 38484558	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12673675, 16937436, 17387384, 17591803, 18619649, 18704463		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16818642, 23060299, 29496520, 29967068		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18983642, 20363910, 28946548, 34421088, 35994813	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	25824382, 27999186		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	31054885		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	30414085		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	26510548		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23339102		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	17268888		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Heart Defects	Congenital heart defects	CTD_human_DG	26073000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	15732037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	19246681, 23640436, 23988176, 25822459, 25968337, 26829118, 29678661, 30332638, 30504732, 31299211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11526493, 12086861, 12697836, 12781449, 12853836, 15184875, 15220362, 15350301, 15492789, 15809750, 15964822, 16205110, 16261165, 16510593, 16600797, 17158546, 17418410, 17482131, 17505508, 17699105, 17998805, 18566226, 18949419, 19483472, 19816521, 20032376, 20437403, 20679884, 20978319, 21042786, 21275466, 21332301, 21547579, 21778301, 21798997, 21875287, 21908555, 21949677, 22286234, 22367210, 22517515, 22614155, 23178531, 23273913, 23298237, 23335244, 23611775, 24136229, 24332042, 24367595, 24390735, 24446253, 24916472, 24916699, 25023703, 25100134, 25421578, 25578041, 25778315, 25830305, 25915846, 26021863, 26474388, 26670202, 26937175, 27029070, 27468719, 27507852, 27834463, 27836247, 28092369, 28110220, 28259286, 28476527, 28492542, 28572533, 28624320, 28851650, 29033184, 29033582, 29218250, 29328439, 29872221, 30144808, 30177838, 30528714, 30539853, 30555801, 30909494, 31268155, 31419966, 31496820		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	22511848, 30355648		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	26727921	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10699162, 15331549, 16100168, 16567545, 21945026, 25082844, 28444966, 30961682, 31096895, 31390562		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16100168, 16567545, 18035072, 24769354, 28444966, 28595632, 30678728, 30941792		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	18418234		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24089028, 28444966, 28595632, 35463986	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27821168, 35866783	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16100168, 16567545, 20846364, 28038803, 28444966		★☆☆☆☆ Found in Text Mining only
Coronary Vessel Anomalies	Coronary Vessel Anomalies	BEFREE	19777592		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	24608455		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24608455, 36091021	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	28051265	Associate	★☆☆☆☆ Found in Text Mining only
CRANIOSYNOSTOSIS, TYPE 2	Craniosynostosis	BEFREE	31499711		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12610101, 25484075, 26802079, 27014752, 37550393	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22157238, 28740109, 30098863		★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	18067639		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29755400		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28885396, 29755400		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	23356225		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17481912, 25239913		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	18779379		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	21420913, 33031374	Associate	★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	30348299		★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	BEFREE	30348299		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	33146980	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29264695		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	12823854, 15987493		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15023385, 15987493, 17393418, 18588890, 21360287, 22249478, 26293784, 27845876, 28343622, 29050208, 30734541, 31055848, 31360308		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	19204000	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	39343901	Associate	★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	29158549		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23333658		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	39312335	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29491093		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	29993193		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29993193		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	37943631	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15561954, 19845601, 20566749, 22790884, 22991450, 23983604, 23984430, 25495026, 27808477, 28280902, 28424212, 28774305, 29362483, 30086330, 30158902, 30401898, 30455857, 30961682, 31214621		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33019392, 36909311	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15561954, 19845601, 20566749, 22790884, 22991450, 23983604, 23984430, 25495026, 27808477, 28280902, 28424212, 28774305, 29362483, 29364466, 30086330, 30158902, 30401898, 30455857, 30961682, 31148250, 31214621, 31715188		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22403299, 35285425	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22991450, 31214621, 32680978, 34680921, 34887659, 35841007, 35956419, 36640318, 37340541, 37365645	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31676796	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19691832	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19691832, 26600509, 28595632, 29690638, 30600310, 32851081	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26847698, 28543639, 29700214, 29860656, 31116982, 31632589, 31720731		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16046581, 19691832, 20440072, 21208194, 21282369, 22302938, 26113285, 28351619, 28595632, 30186489		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Foot	Diabetic foot	Pubtator	34293021, 34474187, 35013299	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	38107519	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	22991450, 26600509, 31214621, 34735495, 40312440	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22991450, 26600509, 28208054, 28648975, 29860656, 30233722, 30387200, 30420600, 30798323, 30899370, 31258644, 31402864, 31611596, 31786195		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	17869204, 24018047, 27288252, 27909871, 29146180, 30178824, 31094072, 31494661, 31689123		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	30007476, 31214621, 32290826, 33023593, 35285425	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	24405857		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23020605, 23022474, 31560931		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	26221035	Associate	★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	31640947		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	37373133	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	31002820	Stimulate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	25447306		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	CTD_human_DG	20526721		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	23992143	Associate	★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	39456258	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyschondroplasias	Dyschondroplasias	BEFREE	28831181, 29504370		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	10831118, 18980686, 21979130, 26940670, 29455633		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	22276609, 27180053		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	39533623	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	20562128	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	27104832	Stimulate	★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	30605014		★☆☆☆☆ Found in Text Mining only
Enchondromatosis	Enchondromatosis	BEFREE	28831181, 29504370		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	25750101		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17341889, 17342330, 17404022, 17418979, 19819950, 22711307, 24042437, 24918449, 25556481, 25884381, 26469226, 27180053, 30539847, 31220580, 31411527, 31819628		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	36937462	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12209691, 17099695, 20565904, 24042437, 24745019, 24918449, 25556481, 26485755, 27634881, 29673664, 30539847, 36285283, 37143105, 38458034	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15160341, 17404022		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28348069, 29860279	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17255327, 22482968, 24796928, 26654708, 26773192, 27385728, 27939762, 28348069, 30566420, 32444257, 35012617, 38458034, 39408909	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24796928, 25750101, 26773192, 27094478, 27939762, 28348069, 28397725, 28673206, 29860279		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28397725, 29860279, 36285283	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	26274503, 29276042, 32657204, 37239335	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	31264974		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	39209164	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	22812626	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	22812626	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24590840, 27554040, 30394322, 30414085, 30621209		★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	17110434	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	27554040		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15297183, 18476949, 20140681, 21701041, 23545606, 26909598, 27044634, 28091613, 31059002		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	30220031		★☆☆☆☆ Found in Text Mining only
Erythrocytosis Familial 2	Erythrocytosis	Pubtator	19062180, 21993671	Associate	★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	BEFREE	17933562		★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	GENOMICS_ENGLAND_DG	22274579		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15771621, 17201171, 19083192, 21519196, 23206445, 27239113, 28627618, 28671053, 29290767, 29616117, 30702111		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15170665		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17201171, 19083192, 20042640, 27239113, 28627618, 29290767, 29616117, 30702111		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17201171, 21945343, 27239113, 31858546, 32068233, 35484214, 35538026, 35937565	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12966423, 15771621, 20042640, 22200953, 25120765, 26370982, 31081089, 31556558, 31858546, 32474512, 35484214, 37938614	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17201171	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	34758666	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17043658, 20637078, 23579072, 23785417, 26393682		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	25181405	Associate	★☆☆☆☆ Found in Text Mining only
Familial erythrocytosis	Erythrocytosis	BEFREE	17933562		★☆☆☆☆ Found in Text Mining only
Familial generalized lipodystrophy	Lipodystrophy	BEFREE	29908837		★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	28434932		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	31846428	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	20110409	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	20846364		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	20846364		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28088462, 30186489, 30242180		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26799785, 28051796, 30102772, 30379980, 30668625, 31411894		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	28817659		★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	29779471		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	17342317, 17999771, 21140472, 21437769, 21628883, 27902314, 30796332		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27260943, 27909731, 28857294, 29156788, 29268190, 29746885, 29881350, 30668625, 31009107, 31455001		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	27840971, 28474313, 31616157		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	20846364		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	25363469	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22470047, 25046749, 25499970, 28077595, 28803245, 30272364, 30556856, 31517732		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	25046749, 33067424, 37142981	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24815301, 30914315		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	15838334		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	LHGDN	15838334		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	16127019	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	25710915		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	30057669	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal angiodysplasia	Gastrointestinal angiodysplasia	BEFREE	30354557		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	28594907	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22489693, 24133624, 29948390		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	24133624	Associate	★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	22820662		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	20412701		★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	12811834		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	18283716, 26239498		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	22644784, 30536725		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	23042279	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28289375, 31274018		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10691731, 12060345, 12082608, 15466170, 16682012, 16849552, 17294421, 17524506, 19587783, 20198320, 20865400, 21084864, 21458987, 21658601, 21818118, 21949677, 22825389, 23429286, 23551342, 23580587, 23712868, 23970362, 24162827, 24465898, 24481065, 24631860, 24747440, 24899388, 25244496, 25423275, 25511738, 25790191, 26045167, 26083570, 26376118, 26559087, 26766590, 26896280, 27472259, 27536856, 27959421, 28252970, 28284719, 28318896, 28327666, 28410215, 28837676, 28994107, 29093638, 29154146, 29262608, 29492900, 29535421, 29625108, 29860315, 29928884, 30013951, 30082910, 30089425, 30144594, 30371540, 30569180, 30621209, 30854062, 30943404, 30951900, 31003211, 31128911, 31252311, 31342232, 31410187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	10691731, 16849552, 17075581, 17132220, 19291283, 19587783, 20488164, 20671264, 21084864, 21179202, 21242296, 23671189, 24075410, 24457964, 24481065, 25010988, 25592037, 27244880, 27536856, 27820599, 28837676, 29492900, 29860315, 30082910, 31410187, 31866995, 31992226, 32088728, 32326742, 32705436, 33762574, 35392912, 36102564, 36142158, 36305723, 36435833, 37382594, 37400829, 38098117, 39709472	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	12811834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	LHGDN	14712484, 16136272		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	26339353	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	10691731, 12082608, 15466170, 16682012, 16849552, 17294421, 17524506, 19587783, 20198320, 20865400, 21084864, 21458987, 21658601, 21756999, 21818118, 21949677, 22825389, 23220408, 23429286, 23551342, 23580587, 23712868, 23970362, 24162827, 24465898, 24631860, 24676782, 24747440, 24899388, 24951116, 25244496, 25423275, 25511738, 25790191, 26045167, 26083570, 26376118, 26559087, 26766590, 26896280, 27472259, 27536856, 27705944, 27959421, 28252970, 28318896, 28327666, 28410215, 28785061, 28994107, 29093638, 29154146, 29492900, 29535421, 29625108, 29860315, 29928884, 30013951, 30082910, 30089425, 30144594, 30371540, 30425242, 30569180, 30854062, 30943404, 30951900, 31003211, 31128911, 31252311, 31342232, 31410187		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	12811834		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11943784, 17075581, 17699105, 19359588, 20671264, 21050481, 21517260, 22700754, 23671189, 23911596, 24970694, 25758142, 26324126, 27163161, 27577073, 28061476, 28410212, 29436645, 30358223, 30988674, 31066901, 31530290, 31554859, 33174046, 33919449, 34118979, 34798125, 35013529, 35058510, 35603730, 35894143, 35939916, 36799154, 36809279, 37086071, 37194413	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15695405, 16596228, 16612574, 16709030, 17332917, 17438103, 17524506, 17699105, 17704802, 18937067, 19296675, 19301653, 20515450, 21329466, 21517260, 21756999, 22309944, 22399191, 22614725, 23263745, 23358800, 23870899, 23911596, 24162827, 24228093, 24374745, 24859610, 25277131, 25423275, 25523098, 25527128, 25758142, 25813354, 26324126, 27090014, 27820599, 28386333, 28410215, 28427209, 28801626, 28813675, 28886531, 29156717, 29330804, 29436645, 29625108, 29754996, 30089425, 30943404, 31263678, 31677055		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16596228, 16612574, 17075581, 17438103, 18055454		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25277131, 27820599	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26538165	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	24577260	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32791747, 34823491	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	23481058, 27503806, 29860656		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	31635898		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	39526770	Associate	★☆☆☆☆ Found in Text Mining only
Glucose-6-phosphate transport defect	Glucose-6-Phosphate Transport Defect	BEFREE	24565827		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	24565827	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30103950		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	20032376, 32767964	Associate	★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24080368, 29319128		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	29319128, 35008579	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	21979946, 27014752		★☆☆☆☆ Found in Text Mining only
Hamman-Rich Disease	Diffuse interstitial pulmonary fibrosis	CTD_human_DG	28434932		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	26790951, 26846782		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	33916948, 36807042	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20019845, 23028863, 24367595, 25596376, 29616117, 30458787		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	16412252, 21945343, 30458787, 30642292, 35860430, 39684472	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	16826581		★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	39526770	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	27450023	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	14526383, 29050006, 30922078		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17617866, 34612779, 36674945	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	15732037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	15951350, 23640436, 31375661, 36435742	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	19246681, 23640436, 23988176, 25822459, 25968337, 26829118, 29678661, 30332638, 30504732, 31299211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	15732037		★☆☆☆☆ Found in Text Mining only
Heart Injuries	Cardiac injury	Pubtator	35777901	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	11114720, 16024619, 19228690, 25310734, 31296894		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	22900063, 25872592, 28438094, 28977119, 29268640, 30232552, 30342949, 31568612		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	28438094	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	32094357, 32945470, 36181115	Associate	★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	25310734		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	26777415, 30704938		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	35979530	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28137923		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	18630523	Associate	★☆☆☆☆ Found in Text Mining only
HEMIHYPERPLASIA, ISOLATED	Hemihyperplasia	BEFREE	29262646		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	33513852	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	30824757	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	39969331	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	32663496	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	27999186, 37490813	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22986897	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	19846525, 36707650	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12627523, 15217513, 15677538, 30394935, 34706936, 36892943	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Coproporphyria	Hereditary Coproporphyria	BEFREE	30910055		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	23485726, 23786654		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	17520677, 19470762, 21404119		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	27858286		★☆☆☆☆ Found in Text Mining only
Hereditary Papillary Renal Carcinoma	Hereditary Papillary Renal Carcinoma	BEFREE	16600797		★☆☆☆☆ Found in Text Mining only
hereditary paraganglioma	Hereditary Paraganglioma	BEFREE	24465590		★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	29366758, 31461385		★☆☆☆☆ Found in Text Mining only
High altitude pulmonary hypertension	High altitude pulmonary edema	BEFREE	18578644		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	18950958		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	24033233		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	33738869	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28123081		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	36902304	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	36091021	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	31504272		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	15561954, 19057015, 20551925, 21614571, 23983604, 25222223, 27288252, 30217067, 30659610, 31185507, 31214621, 31241439, 31676796		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	30217067, 31214621, 31676796, 34479471	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31214621	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	35088883	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28351619		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	26254226, 26483345		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	33215223	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	17452774	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperplasia	Hyperplasia	Pubtator	19623180, 36892943, 36937462	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypersensitivity Immediate	Hypersensitivity	Pubtator	32723315	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31599436, 32888289, 33652665, 34758666, 38002309	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	18411415, 20110409, 23492195, 27432037, 27811062, 32098916, 36323673	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	26414702	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16373853, 18083891, 18692603, 23513056, 23844087, 24101470, 25231004, 25301555, 25480333, 25772710, 25824146, 25847948, 26586659, 26987380, 27363580, 27432037, 27811062, 28445205, 28565876, 29028080, 30058708, 30233722, 30819028, 30831131, 31086178, 31319406, 31515405, 31537914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	18083891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22349312		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	28974422		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	23007030		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	28951244, 35681536	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	31599436	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	11803471, 15592500, 20637078, 30524296		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	36640318	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	23871585	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10364451, 10607702, 11278891, 11494119, 11741593, 11852072, 12070140, 12086154, 12242281, 12401798, 12468553, 12764143, 12900407, 15220362, 15310764, 15379897, 15719438, 15951350, 16151532, 16242072, 16294025, 16399861, 16849522, 17028170, 17075581, 17442736, 17488873, 17953712, 17978497, 18172210, 18385176, 18587495, 18842833, 19091749, 19139726, 19151763, 19211554, 19223463, 19225555, 19293442, 19305150, 19574782, 19592460, 19661326, 19808899, 19921787, 19959878, 20003295, 20010940, 20026900, 20109337, 20110409, 20175781, 20473281, 20637078, 20727156, 20729179, 20829524, 21048308, 21078189, 21357506, 21557221, 21576240, 21628883, 21629773, 21980400, 21984181, 22172637, 22202117, 22275240, 22363512, 22453051, 22932900, 23307318, 23364970, 23388440, 23549264, 23579072, 23824493, 23852087, 23879962, 23927384, 23958427, 23965235, 23966163, 24040331, 24347168, 24427353, 24462831, 24561986, 24590895, 24634093, 24729089, 24739438, 24818601, 24825851, 24901645, 24975222, 25040744, 25072260, 25115400, 25119596, 25120765, 25166211, 25168373, 25312721, 25420025, 25501705, 25592037, 25630799, 25688362, 25777304, 25861162, 25956355, 25988388, 26017562, 26061431, 26193287, 26223692, 26375488, 26388611, 26394152, 26610526, 26882567, 26884855, 26984380, 27035330, 27432037, 27450023, 27536856, 27909731, 27934968, 27966740, 28028936, 28067317, 28169245, 28401704, 28407653, 28415624, 28429366, 28438094, 28445935, 28537679, 28590414, 28806945, 29243776, 29393397, 29568752, 29578197, 29695901, 29708817, 29746587, 29749460, 29997451, 30214007, 30255592, 30320358, 30504760, 30556863, 30560881, 30669593, 30813460, 30813635, 31116583, 31319505, 31364741, 31402756, 31462898, 31694368, 31769345, 31935962, 31980706, 32085516, 32426814, 32439898, 32645661, 32858793, 32998265, 33029691, 33215223, 33299319, 33378978, 33491566, 33537802, 33721728, 34108245, 34162953, 34254261, 34382917, 34445747, 34456926, 34471053, 34494499, 34557995, 34663515, 34942165, 35008634, 35063407, 35163668, 35186183, 35244188, 35417854, 35484214, 35611851, 35634326, 35672694, 35753261, 35837487, 35919821, 35937460, 36285283, 36473847, 36656644, 36810972, 36982788, 37179372, 37909728, 38002309, 8260699, 9236155	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10446187, 10691731, 10699162, 10866824, 10926858, 10933058, 11676860, 11707426, 11739718, 11877282, 11943784, 11971899, 12136249, 12209691, 12354771, 12387890, 12482504, 12615973, 12671706, 12767996, 12808024, 12844285, 12885785, 12939282, 14507651, 14604972, 14681229, 14702352, 14726398, 14984367, 14992692, 15082527, 15084243, 15104534, 15199132, 15211754, 15217513, 15322093, 15341671, 15474002, 15475194, 15598882, 15611089, 15623945, 15677538, 15780936, 15802268, 15802864, 15833446, 15901372, 15987743, 16035955, 16053510, 16080559, 16204076, 16228978, 16251878, 16386771, 16417408, 16421254, 16438736, 16456867, 16489029, 16543242, 16732616, 16798617, 16809612, 16849552, 16873253, 16886625, 16899602, 16956952, 17102128, 17140257, 17156434, 17255327, 17270179, 17292638, 17325032, 17403672, 17406354, 17452774, 17532031, 17567660, 17597534, 17608772, 17609976, 17719840, 17785433, 17999771, 18050215, 18062927, 18174379, 18270456, 18285700, 18316553, 18351386, 18366759, 18381358, 18419598, 18422749, 18507049, 18544165, 18562694, 18616527, 18618497, 18708761, 18718909, 18976673, 18980686, 19061491, 19128456, 19183269, 19240180, 19251694, 19265129, 19279559, 19287200, 19291283, 19321184, 19349275, 19383717, 19390242, 19403667, 19406746, 19540709, 19542490, 19546348, 19568272, 19619276, 19644855, 19706526, 19714248, 19726677, 20003191, 20032376, 20037203, 20042640, 20102637, 20153296, 20164027, 20166137, 20224786, 20228066, 20335389, 20363910, 20395301, 20442286, 20442290, 20491781, 20498644, 20540786, 20544685, 20559021, 20565904, 20569445, 20603601, 20624302, 20626868, 20661931, 20668552, 20831794, 20924210, 20927579, 20930543, 21050481, 21084864, 21150341, 21179202, 21224490, 21233846, 21266348, 21281817, 21332301, 21333376, 21368208, 21388517, 21389259, 21420913, 21448846, 21477371, 21483406, 21502812, 21555452, 21571835, 21595915, 21640519, 21641407, 21672245, 21824412, 21840307, 21862591, 21880716, 21881486, 21887310, 21897387, 21911602, 21917920, 21925214, 21930697, 21949677, 21964756, 21966417, 22025560, 22038225, 22094876, 22104271, 22116304, 22214851, 22249478, 22258474, 22343000, 22380870, 22402494, 22429763, 22467238, 22482968, 22516347, 22542128, 22615960, 22700754, 22754381, 22781303, 22812626, 22855837, 22866899, 22870988, 22894905, 22901169, 22937154, 22970168, 22991450, 22998595, 23028863, 23067574, 23082872, 23090068, 23098453, 23119050, 23144021, 23144690, 23178531, 23289374, 23314174, 23372804, 23377827, 23409121, 23424623, 23455892, 23474946, 23496980, 23545606, 23602831, 23664601, 23667251, 23696831, 23726431, 23746844, 23756865, 23778527, 23786654, 23788753, 23792163, 23810808, 23869589, 23935399, 23991099, 23992143, 24002598, 24008827, 24042437, 24061475, 24063008, 24083758, 24090974, 24120591, 24131792, 24138815, 24213609, 24260273, 24275182, 24301659, 24316875, 24344305, 24356968, 24394419, 24416312, 24421387, 24436242, 24457463, 24457964, 24474252, 24497137, 24504474, 24505470, 24567056, 24593195, 24599003, 24618817, 24629239, 24657063, 24662455, 24696491, 24737584, 24801981, 24840724, 24858344, 24893647, 24894671, 24918449, 24919196, 24931519, 24937673, 25019382, 25081716, 25093297, 25096400, 25103413, 25129238, 25185259, 25187556, 25263561, 25323032, 25405996, 25510668, 25520138, 25556481, 25596742, 25605240, 25740019, 25813626, 25884381, 25887043, 25889814, 25955133, 26003166, 26010887, 26045293, 26046764, 26059435, 26079208, 26191163, 26192455, 26207380, 26228060, 26229239, 26323347, 26324126, 26339163, 26368009, 26379394, 26421357, 26464645, 26515140, 26515145, 26538165, 26598706, 26598923, 26701969, 26785721, 26825173, 26841847, 26846577, 26849233, 26867730, 26882120, 26910835, 26914112, 26974319, 27001847, 27012941, 27015368, 27044634, 27121066, 27129235, 27191981, 27225200, 27231905, 27245780, 27260001, 27303043, 27362802, 27367674, 27448695, 27460728, 27487122, 27535224, 27535970, 27542232, 27577073, 27599042, 27604859, 27629849, 27634881, 27644248, 27733565, 27743994, 27779676, 27807254, 27835695, 27858190, 28038470, 28038803, 28061476, 28097375, 28117678, 28193910, 28198519, 28214471, 28257048, 28320353, 28348069, 28401064, 28410212, 28420760, 28423489, 28426715, 28435451, 28449718, 28468237, 28474313, 28475017, 28486050, 28550313, 28552779, 28558056, 28591654, 28613371, 28653891, 28686797, 28758418, 28760843, 28764685, 28808304, 28894087, 28911625, 28922425, 28978620, 29109451, 29117193, 29123322, 29145444, 29230415, 29237157, 29289482, 29304733, 29337896, 29426376, 29444873, 29464284, 29475939, 29482638, 29484680, 29492900, 29518129, 29596470, 29626597, 29708435, 29739381, 29760417, 29770329, 29860315, 29881400, 29898734, 29966011, 29991707, 30006568, 30032670, 30037853, 30065361, 30082910, 30100905, 30121667, 30222022, 30241031, 30258464, 30332653, 30367082, 30383835, 30402847, 30535970, 30539847, 30587688, 30638864, 30642030, 30659163, 30665327, 30670058, 30678691, 30808328, 30837551, 30876462, 30896865, 30909668, 30948460, 31017266, 31061665, 31077234, 31078780, 31088860, 31088908, 31146637, 31163125, 31175269, 31189709, 31207090, 31214621, 31291905, 31407387, 31422771, 31427440, 31467922, 31486323, 31554283, 31587013, 31676796, 31690629, 31740787, 31810452, 31819173, 31858546, 31925944, 31931758, 31965981, 32033172, 32062551, 32088728, 32114885, 32194829, 32215176, 32255193, 32312328, 32352161, 32436609, 32463297, 32531951, 32641480, 32673430, 32767964, 32810507, 33067558, 33173052, 33228233, 33231338, 33261601, 33273139, 33290263, 33326735, 33345622, 33478328, 33499904, 33533018, 33574667, 33581682, 33599733, 33639646, 33640700, 33655764, 33681390, 33737411, 33758342, 33762574, 34079086, 34197482, 34210337, 34237211, 34279223, 34299186, 34388291, 34479471, 34493285, 34609072, 34642392, 34667186, 34680921, 34836938, 34887659, 34903711, 34933912, 34969360, 34999917, 35006885, 35031618, 35055064, 35140333, 35186110, 35227773, 35283481, 35285425, 35309179, 35338412, 35351136, 35368338, 35381759, 35409364, 35413842, 35447566, 35468342, 35538026, 35543151, 35603730, 35635094, 35638109, 35666067, 35705627, 35729160, 35733918, 35764883, 35765115, 35792080, 35813480, 35853902, 35931888, 35942521, 35985176, 36012235, 36077517, 36139362, 36142220, 36142656, 36157928, 36160709, 36195570, 36230969, 36230977, 36232817, 36244759, 36308177, 36327483, 36332389, 36341521, 36359819, 36369467, 36376373, 36416348, 36421334, 36461588, 36469955, 36481701, 36641657, 36656861, 36678267, 36741966, 36748335, 36748372, 36807042, 36814597, 36912618, 36928344, 36937462, 37020036, 37029581, 37029804, 37042842, 37063425, 37067635, 37081097, 37108039, 37108312, 37146419, 37149664, 37239335, 37240301, 37315872, 37329213, 37400829, 37446376, 37517933, 37526979, 37633048, 37666879, 37748565, 37752569, 37786443, 37807875, 37813876, 37821935, 37905653, 38012382, 38104132, 38158708, 38319579, 38372346, 38458034, 38478356, 38517892, 39197198, 39209164, 39343901, 39456823, 39528935, 39674878, 39913285, 40582945, 40594164, 40598910, 40613289, 8816435, 9588211, 9636155	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25961573, 26867977, 32886165	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	BEFREE	20874696, 29724989, 30836371		★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	CTD_human_DG	23694759		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	25339014		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	24927770, 26837714, 30513863		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	18083891, 18261897, 20110409, 21819559, 22511751, 24270264, 26071969, 26084306, 27149112, 27343087, 27667582, 27811062, 28565755, 28715868, 30266526, 30802452, 30819028, 30909527, 30982984, 31195886, 31242023, 31391533, 31488850		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	27104832	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	28434932		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28446589, 28701304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36656644, 37978501	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	20110409, 29074488, 29745253		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28962641, 29050006		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	28771276		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27589564, 28527810		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28529459, 28887194, 29620198		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	23408345, 26940670		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	12610101, 24301659, 25484075, 29307990, 37550393	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15489957, 22457366, 23119050, 27921309, 29967068, 30455703, 31063937, 31241981		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26871994, 32651353, 34646087	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	26901836, 28495754, 28526405, 31740659		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32723315, 34394829, 36814575, 37266623	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	23991178	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	26847698, 28543639, 29700214, 31632589		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	17179985	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	16865676, 23718763		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	31498485		★☆☆☆☆ Found in Text Mining only
Intracranial Astrocytoma	Intracranial Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	21982637, 31704828		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	17685448, 21877141, 23728336, 27862063		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	25239913, 28460338		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22457366		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	25884818		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26746864, 28536255, 29340071, 29377234, 30218809, 30710045, 31297056		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31589938		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	18512817		★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	16873253, 16899596, 17634230, 19360424, 19429708, 24278015, 31189709, 31809522		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	Pubtator	28573109	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	31467338, 32886165	Associate	★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	28238093, 31319505		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	28685447		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22991450, 23481058, 23792300, 29501969, 30315965, 31317578, 31537914		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	23481058	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	28181420	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	35908957	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	19144758, 19279559, 24335166, 26044673, 27127787, 27266727, 29667230, 30257316, 30325740, 30418172, 31691948		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	24703425, 25822459, 30755161, 30918132		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11431362, 16600797, 22776233, 23449350		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	16920734		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21233420, 21386837, 23449350, 24625422, 26743088, 30832444, 32586940, 34494499	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	27173353		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21227008, 24083758, 24677746, 25412955, 36469955	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23087365		★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	24980293	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	31599436		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	15732037		★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Leigh syndrome	Pubtator	30995105	Associate	★☆☆☆☆ Found in Text Mining only
Leigh syndrome , French Canadian type	Leigh syndrome	BEFREE	30995105		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34942165, 35377824	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	28404817		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	29706348		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18239067, 18996491		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20166137, 21880716, 22948410, 24016597	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22041818, 24160851, 25727291, 26825709, 27082496, 27196781, 30595549, 31413262		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	18728026	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18728026, 22948410, 24641416, 24966925, 26218201, 27082496, 30909668, 34895042, 37807875, 39343915	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27002764	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39993966	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17637739, 18728026, 19853583, 21868571, 23059786, 23262180, 24641416, 26613208, 26642852, 27002764, 27082496, 29212263, 29487418, 30595549, 30638859, 31617641		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	28062918		★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	23991178		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	27467582		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31527445		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19449077, 19717330, 21332579, 25105148, 25496056, 28639619		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11557773, 12514119, 12821940, 14672622, 15349906, 16471319, 16629644, 16685395, 16738327, 16951224, 17145871, 17202857, 18188720, 18264140, 18651980, 18813785, 18978810, 19016766, 19447872, 20213095, 20383692, 20460486, 20513003, 20524035, 20648588, 21140472, 21181559, 21332301, 21557766, 21667015, 21748762, 21847633, 21950556, 22479397, 22512580, 22512980, 23307318, 23496980, 23581228, 23618526, 23702609, 23791554, 23799043, 23933019, 23966163, 24057240, 24100543, 24194905, 24321089, 24346287, 24362462, 24374892, 24445728, 24566861, 24590895, 24686083, 24853275, 24895585, 24916276, 24927229, 25052749, 25101278, 25166596, 25195037, 25231214, 25267273, 25323032, 25531114, 25537504, 25596085, 25714015, 25745995, 25749383, 25766328, 25823824, 25824382, 26078356, 26086159, 26115041, 26299656, 26381739, 26456310, 26612965, 26621849, 26675549, 26799785, 26861561, 26884845, 26884855, 26984380, 27027353, 27153552, 27249600, 27524242, 27638772, 27644248, 27807254, 27840976, 27913861, 27934882, 28062918, 28074862, 28119236, 28167508, 28258134, 28387640, 28449718, 28485808, 28529605, 28560008, 28653891, 28855849, 28894087, 28926527, 28974422, 29084919, 29137263, 29171040, 29237157, 29439255, 29491214, 29525633, 29724996, 29748591, 29799025, 29866133, 29881400, 29917189, 29970668, 30180863, 30226584, 30250300, 30258464, 30271487, 30274686, 30367150, 30479372, 30535970, 30644610, 30673593, 30718359, 30813635, 30917505, 30981500, 31037150, 31100412, 31101057, 31218114, 31239764, 31247273, 31496732, 31776228, 31807009, 31819034, 31819036, 8917436, 9692838		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12485909, 16629644, 18465238, 18813785		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21557766, 24057240, 25824382, 30274686		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	28112200, 33673041	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	BEFREE	27899277		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11557773, 12514119, 14672622, 16738327, 17202857, 18978810, 21140472, 21950556, 23581228, 23618526, 23791554, 25714015, 26299656, 28974422, 29171040, 30897274, 8917436, 9692838		★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	23991178		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	15113858, 21420913, 23492195, 27245780, 32098916, 33810600, 35259405	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	19245702, 26508030, 30703512		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	CTD_human_DG	20152896		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	33178179	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15935515, 17335808		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17699846	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19176399, 19305150, 19546348, 22349311, 22467238, 23295589, 25460312, 25813626, 26035432, 26508030, 26548300, 27708247, 28028936, 28423489, 28537679, 29891977, 30338933, 30665327, 31491447, 31601776, 31963541, 32209219, 32645661, 34044859, 34194828, 34891118, 35672694, 37041291, 37400960, 37948404, 39327549	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20660313, 22331677, 22467238, 23246962, 27226640, 28197372		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30043119		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	37526979	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30043119		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24232601, 30043119, 30572770		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27878241		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	32085620, 37526979	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30043119		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	12941820, 23375385, 25316231		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12966423, 17461470, 32473641	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16251878, 18630523, 19305150, 20217131, 20953377, 21330825, 21778301, 23012449, 23545606, 23927384, 23935399, 24427353, 25081716, 25119596, 25120765, 25377659, 25446376, 25717256, 26846782, 26985936, 27629849, 30539847, 31057297, 32644049, 32883954, 34319022, 36327483, 36897686, 40598215	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21213129	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	30431105	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28860338		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17785204, 19016766, 20813154, 22751135, 29335581, 30065361, 31411003		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	19021062		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30065361, 32533646	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18422776	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23013270		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	31226340	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	28404817		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16612574, 17332917, 23263745, 24705306, 24781871, 25527128, 27536856, 29069732, 31678282		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	20019845, 22804960, 23028863, 24367595, 25596376, 29616117, 30458787		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	27119351		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	29097800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12242695, 12402159, 14580258, 15217513, 15623945, 15695405, 16337862, 16585198, 16954428, 17140257, 17483326, 17957335, 18030615, 18160046, 18316553, 18670636, 18949419, 19212630, 19231068, 19307182, 19390242, 19580347, 19766100, 20035632, 20307196, 20442288, 20526721, 20624301, 20682797, 20727020, 21036805, 21069452, 21266576, 21266827, 21291529, 21338575, 21397863, 21496870, 21514280, 21746877, 21877141, 21897387, 21911388, 22043993, 22231744, 22320863, 22875853, 22894905, 22921864, 23065205, 23129632, 23409121, 23409769, 23423382, 23566437, 23667251, 23696831, 23728336, 23749907, 23832257, 23870899, 23925655, 23947803, 24349381, 24457463, 24472707, 24648344, 24659092, 24737252, 25069832, 25270118, 25334080, 25453096, 25484025, 25496056, 25510668, 25520138, 25535357, 25556440, 25579062, 25587023, 25596742, 25920936, 25976207, 26046764, 26158266, 26174737, 26196741, 26229077, 26239613, 26287601, 26339588, 26512116, 26520789, 26598706, 26598923, 26648580, 26718330, 26745120, 26921175, 27105516, 27184798, 27185877, 27303043, 27325313, 27497816, 27590511, 27805252, 27862063, 28039264, 28089831, 28239645, 28320353, 28351619, 28485159, 28559303, 28574600, 28739726, 28927155, 29053417, 29180628, 29254140, 29275212, 29283324, 29367761, 29391899, 29393454, 29599405, 29629903, 29725006, 29880481, 29913554, 29976963, 29996493, 30135144, 30157616, 30275854, 30537744, 30538116, 30572455, 30609375, 30635931, 30774370, 30930227, 30930461, 30936474, 30940798, 30943919, 31062127, 31078780, 31254605, 31359335, 31481238, 31529195, 31554283, 31577739, 31705798, 31750963, 31773719, 31821370		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	24349381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17404022, 19819950, 22711307, 24918449, 25556481, 26469226, 31220580, 31411527, 31819628		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17201171, 19083192, 20977428, 27239113, 28627618, 29290767, 29616117, 30702111		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	21415706, 25046749, 25499970, 28077595, 28803245, 30272364, 31517732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24063654, 24293391, 25158249, 29578149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	15821583, 21233420, 21908555, 22012259, 22037472, 24332042		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	25412955, 28878571		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21460102, 24362462, 25158249, 25166596, 25661370, 25736100, 26984380, 27840976, 28123525, 29028096, 29748591, 29753285, 30226584, 30897274, 31057657, 31772626		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12593853, 16397226, 17335808, 19176399, 19305150, 20885442, 21435097, 21666710, 21812995, 21965273, 22153809, 22349311, 22467238, 23275310, 23448368, 23526365, 24008975, 24403227, 24793809, 24824937, 25556481, 25748238, 26002230, 26508030, 26528854, 26548300, 27423680, 28028936, 28259980, 28423489, 28537679, 28610954, 28838387, 29207023, 29393397, 29616117, 29891977, 29904944, 30015910, 30128035, 30250643, 30338933, 30539834, 30617444, 30628067, 30634531, 30665327, 30816548, 31004547, 31061665, 31221150, 31656668, 31802910, 31839825		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19449077, 19717330, 21332579, 25105148, 25496056, 28639619		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11410504, 11804750, 14507651, 17498666, 19014607, 19016748, 20398289, 23389731, 25174950, 25491408, 25756515, 25975373, 26548925, 26801746, 28401704, 28459376, 28878214, 29797601, 30867818, 30912527, 31077234, 31175269, 31437208, 31587013, 31639424, 31700155, 31851935		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12499918, 12651620, 16552335, 16628086, 16998831, 17312464, 17534684, 17651733, 18509748, 18592007, 19414389, 19417024, 19445542, 20556833, 20587661, 21709439, 21778785, 21922147, 22472348, 22487528, 22825513, 22970168, 23377827, 23467940, 23485726, 23633488, 23924606, 23979441, 24008827, 24198204, 24367595, 24509158, 24561118, 24575976, 25385028, 25497868, 25655308, 25853522, 26094625, 26497365, 26715642, 26785721, 27367674, 27566398, 28069592, 28697344, 28801636, 28810656, 28928287, 29038348, 29152137, 29396728, 29476053, 29535824, 29702094, 29758199, 30056064, 30455857, 30481072, 30867721, 31100311, 31119050, 31239153, 31241439, 31367258, 31402756, 31410216, 31585939, 31638231		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	16628086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11059752, 11980636, 12136249, 15538748, 16432534, 16701010, 16954428, 16956360, 16998808, 17213816, 17237281, 17426252, 17562539, 17624927, 18398039, 18506761, 18563715, 18949419, 19016246, 19096962, 19106642, 19211554, 19845601, 20564320, 20651983, 21037926, 21480310, 21500193, 21628883, 21649463, 21909688, 22083267, 22355351, 22505354, 22516347, 22537539, 22647679, 23042446, 23185615, 23342109, 23594994, 23723982, 23831623, 23870899, 23924028, 24035332, 24090974, 24435707, 24504474, 24599003, 24775564, 25349289, 26010887, 26096936, 26450901, 27448695, 28165392, 28167510, 28415653, 28760843, 28790395, 28974155, 29137361, 29315957, 29492208, 29658569, 29708817, 29742803, 29760417, 29885835, 30174456, 30216369, 30357756, 30488478, 30531685, 30745829, 30837551, 31012989, 31364741, 31419966, 31771535, 31848297		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16205110		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	19276359		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28613371, 29064206		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17953712, 18708754, 19048182, 19223895, 19504235, 20491781, 20559021, 21281785, 21779800, 22350022, 23023480, 24057269, 24165223, 24287180, 24927122, 25040744, 25761483, 26292288, 26329876, 26339797, 26406411, 26760764, 26793992, 27016414, 27902480, 28819379, 28901473, 29603227, 29737213, 29785022, 29899167, 29904245, 30093943, 30500418, 30705965, 30782242, 30851060, 31057297, 31222863, 31423208, 31673244		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thymus	Malignant Neoplasm Of Thymus	BEFREE	26254278		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	14602779, 25862859, 27840971, 30768848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	25564169		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11350893, 15821583, 18000826, 24584933, 24737584, 25266796, 25824695, 26541358, 26717965, 27181362, 27196763, 27557492, 28263974, 28710377, 29267502, 29317342, 29467870, 29693166, 30026847, 30315244		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10849654, 11522653, 11793372, 12124175, 12195866, 12499918, 12507560, 12532423, 12558074, 12900407, 13130303, 14988927, 15048086, 15086970, 15113858, 15135470, 15141023, 15240510, 15272235, 15313402, 15466170, 15474002, 15476674, 15479785, 15538748, 15592500, 15669079, 15695405, 15771621, 16002209, 16144692, 16337862, 16452228, 16516853, 16596228, 16682012, 16880289, 16889900, 16929169, 16998831, 17047048, 17372907, 17418979, 17431122, 17498666, 17534684, 17555795, 17557121, 17563752, 17764071, 17931419, 17933687, 17998062, 18026974, 18030615, 18083891, 18258605, 18632605, 18639543, 18707725, 18766298, 19029826, 19074877, 19114105, 19124237, 19186072, 19221478, 19409433, 19459851, 19519293, 19574782, 19671045, 19671047, 19689405, 19737107, 19942427, 19946328, 19962963, 20020496, 20035632, 20198320, 20398289, 20428865, 20515450, 20599784, 20702724, 20706634, 20819065, 20857420, 21042279, 21073737, 21152246, 21275466, 21303984, 21330825, 21364021, 21397863, 21625848, 21628883, 21671859, 21693763, 21709315, 21709439, 21751260, 21778785, 21887463, 21887475, 21890452, 21945343, 21949677, 21981137, 21982637, 22102864, 22105711, 22178933, 22186139, 22202117, 22219185, 22318330, 22348829, 22367292, 22428047, 22582814, 22614004, 22614155, 22647679, 22672828, 22820662, 22894905, 22914908, 22923450, 22926560, 22961911, 23059786, 23082872, 23123638, 23149916, 23178531, 23184277, 23225225, 23257898, 23301832, 23375385, 23429286, 23448368, 23458834, 23467940, 23523103, 23568779, 23604114, 23667251, 23707522, 23707765, 23723982, 23727790, 23857282, 23870899, 23879962, 23920275, 23922721, 23947803, 23977378, 24015181, 24022342, 24046090, 24063654, 24090974, 24161739, 24260383, 24286852, 24293391, 24316875, 24333432, 24336068, 24344197, 24367595, 24412777, 24423936, 24425105, 24457463, 24465898, 24472707, 24485121, 24567056, 24576222, 24744144, 24804733, 24824937, 24859886, 24916276, 24927229, 24969897, 25051115, 25068796, 25072260, 25117331, 25166596, 25249501, 25270118, 25334080, 25426963, 25489981, 25496056, 25531325, 25556481, 25589622, 25603055, 25663785, 25688508, 25725157, 25749383, 25756515, 25824695, 25920936, 25939381, 25976207, 26034980, 26057751, 26096936, 26115041, 26146622, 26254226, 26297910, 26409325, 26420856, 26469226, 26469830, 26474388, 26545811, 26648580, 26702059, 26706021, 26719577, 26757928, 26761211, 26784107, 26799785, 26801746, 26820502, 26859780, 26882240, 26882567, 26938486, 26948053, 27029070, 27037062, 27108616, 27122154, 27128972, 27137755, 27144516, 27263528, 27325313, 27394002, 27430909, 27447861, 27589564, 27616748, 27644243, 27693630, 27708244, 27809360, 27909249, 27976736, 27978620, 27986921, 28036268, 28045433, 28162269, 28169245, 28249000, 28257048, 28258134, 28263977, 28273642, 28318896, 28358664, 28366537, 28398871, 28407653, 28410215, 28476028, 28569777, 28574600, 28617871, 28684144, 28704917, 28734980, 28761052, 28781970, 28790395, 28851650, 28878214, 28883660, 28912885, 29064206, 29065834, 29084916, 29112209, 29158891, 29180628, 29230384, 29251629, 29256392, 29278273, 29285833, 29330793, 29386184, 29396728, 29407528, 29413596, 29434038, 29545478, 29565467, 29587825, 29624460, 29675970, 29693166, 29706190, 29708817, 29753878, 29797601, 29866021, 29880481, 29917189, 29925335, 29960020, 30065361, 30089425, 30108689, 30128230, 30144594, 30180863, 30271487, 30275854, 30315965, 30321514, 30367042, 30379148, 30385524, 30410397, 30481072, 30488478, 30528714, 30535970, 30538116, 30544833, 30605014, 30609861, 30634433, 30695991, 30728113, 30782242, 30784357, 30787326, 30819620, 30837551, 30840126, 30844107, 30885992, 30902790, 30904401, 30917505, 30940320, 30943919, 31043706, 31070059, 31083403, 31086178, 31088067, 31175269, 31201715, 31233197, 31259781, 31297056, 31318683, 31319979, 31323773, 31342232, 31392931, 31485300, 31500591, 31521236, 31530011, 31531455, 31556611, 31678210, 31681292, 31711773, 31724069, 31729096, 31737187, 31739546, 31740202, 31744467, 31772647, 31784651, 31810777, 31813546, 31824854, 31841190, 31843464, 9142119		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	25833823, 28558056, 29543881		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	30458787		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20206160, 20627616, 21330825, 22925504, 23375385, 24195510, 25337255, 25905434, 26718775, 27593081, 29207048, 29654110, 30355300, 31452725		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14996738, 16127434, 16452228, 16543245, 16701010, 17431122, 17488804, 18365547, 19435875, 19843849, 20407014, 20429620, 20514449, 20599784, 20691219, 21629773, 21748762, 23880760, 24629239, 24718784, 24901645, 25316231, 25978030, 25979228, 26183215, 26503233, 26882567, 26996300, 27144516, 27543779, 27573201, 27793037, 28061476, 28341244, 28486050, 28864720, 28936522, 29467884, 29630948, 30357530, 30746305, 30885992, 31420015, 31849679		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	26646563		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	26646563	Inhibit	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	24349381		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14559790, 15084243, 15342390, 15656883, 16337862, 16555123, 16899602, 17653093, 17676480, 17805961, 17999410, 18030615, 18160046, 18279708, 18563339, 18949419		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15509511, 16516853, 16819549, 17958397, 20824128, 21462085, 21755341, 23566437, 23728336, 25069832, 26287601, 26598923, 28272508, 28320353, 29180628, 29212519, 29246543, 29532562, 29629903, 29959560		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	24349381		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	24349381		★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	30280214		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28404916		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20827750, 23082872, 28302031, 30320358		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	30227871, 30320358	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	24997364		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12205045, 17308114, 17409425, 19066596, 19919690, 19934275, 20055873, 20927579, 21233846, 21703345, 21949374, 22012259, 22865452, 22926523, 23161568, 23275444, 23355370, 23474946, 24090196, 24812272, 24997364, 25073704, 25891797, 25997619, 26547841, 26787841, 27042054, 27220837, 27542908, 28012930, 28168807, 28257048, 28577299, 28762556, 28781622, 28885396, 29755400, 29924728, 30065361, 30504385, 30613921, 30653763, 30887251, 31287590, 31310363, 31371307		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14512791, 15983061, 16826425		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16396931, 19794965, 19934275, 20668552, 21233846, 23275444, 23474946, 26221040, 26375488, 26547841, 26787841, 27042054, 27542908, 28257048, 28339028, 28762556, 30065361, 31287590, 32432754, 33118214, 33344042, 33581682, 36142656	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19919690	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma, Amelanotic	Melanoma	BEFREE	24997364		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	12296651		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23877362, 32705667, 32908869	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	25310734		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	LHGDN	18385176		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	26544728, 36656861	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	23879962, 26544728, 30111297	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	17325032		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	17325032, 25956355, 39209164	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30275460		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22039494, 34410257	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22865452, 26547841, 31287590		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24090974, 29024573		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	37390241	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	23740939, 27858285		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	30385524		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19846525, 20885442, 22216344, 25460312, 25833255, 28426671, 32096549	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36973679	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	Pubtator	33655764	Associate	★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor neuron atrophy	Motor neuron atrophy	BEFREE	23368766, 31344397		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	15901372, 25105148, 31711427, 32255193, 34318593	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	17532031, 18026974		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20066420		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	32808647	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Mucopolysaccharidosis	Pubtator	24083598	Associate	★☆☆☆☆ Found in Text Mining only
Multiple fibrofolliculomas	Multiple Fibrofolliculomas	BEFREE	16600797		★☆☆☆☆ Found in Text Mining only
Multiple Hemangioblastomas	Multiple Hemangioblastomas	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15623651, 19525194, 20404562, 23113684, 23344526, 23478664, 24297864, 24732040, 24839982, 25050627, 25769724, 26867162, 26976208, 29882856, 30108468, 30353128, 31289203		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16234364, 17848618, 21223249, 24732040, 26867162, 27340936, 28008160, 28509582, 29882856, 30353128, 32714991, 35081971	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18056737, 31652374		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32192527	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	21574524	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36619896	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	38104132	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30711624		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28460338, 30139811, 30385524, 31411003		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	31411003, 33921064	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35642674	Stimulate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	19073171		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	24705490		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	31728053		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25957288		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	15732037		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16842166, 23525439, 23978105, 24253102, 28777704, 28980287, 29652636, 29771427, 30423574, 30504732, 30531686, 30678728		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	24089028, 32399898, 35378513	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	10699162, 15331549, 17541946, 21945026, 23988176, 25082844, 28042316, 30423574, 30961682, 31096895, 31390562		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	10699162, 12914934, 15770733, 16973622	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	34465337	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	31393948		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	29987045		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	30900156		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19101504, 29254228, 29670184		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	32673430	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20109337, 22952803, 23228635, 24335623, 25714020, 25733830, 27567526, 28205588, 28398871, 28892580, 29515112, 29764490, 29888634, 30479336, 30551431, 30555573, 30557400, 30882922, 31320749, 31782911		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22587416, 22952803, 23228635, 24662828, 25377659, 31782911, 32432742, 32679194, 33099941, 33725777, 36541519	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	12759237, 16080559, 17075581, 18351386, 20565904, 20637078, 23640464, 27629849, 28474313	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30943919	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29068435, 29276042		★☆☆☆☆ Found in Text Mining only
Nemaline myopathy 5	Nemaline myopathy	Pubtator	16035955	Associate	★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	BEFREE	29975766		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10353251, 10847587, 10944113, 11156414, 11359907, 11410504, 11431362, 11676860, 11772947, 11803471, 11986208, 12136249, 12393546, 12499918, 12558074, 12673675, 12781449, 12853836, 12928580, 12941820, 13130303, 14672622, 14695194, 15003941, 15035285, 15048086, 15135470, 15141023, 15169887, 15199114, 15220362, 15280403, 15300796, 15312748, 15313402, 15341671, 15363541, 15459006, 15538748, 15543236, 15591418, 15592500, 15623945, 15695405, 15771621, 15814637, 15824735, 15878106, 15919761, 15930287, 15964822, 15994919, 15994966, 16010420, 16024619, 16098463, 16098466, 16103076, 16109785, 16127434, 16136500, 16179928, 16273277, 16294030, 16337862, 16412252, 16427735, 16452228, 16489060, 16510175, 16516853, 16518418, 16552335, 16585198, 16600797, 16612574, 16682012, 16685395, 16724682, 16735998, 16740701, 16775835, 16847924, 16899596, 16909104, 16924239, 16924414, 16982770, 16985058, 16998808, 17094412, 17184154, 17201171, 17259560, 17294421, 17310851, 17342317, 17342330, 17359291, 17376295, 17387348, 17400064, 17404022, 17429338, 17461470, 17520257, 17520677, 17524506, 17532031, 17555795, 17557121, 17563752, 17639040, 17786294, 17826033, 17848618, 17931419, 17958397, 17967865, 17998062, 17998066, 18003981, 18023174, 18026974, 18030615, 18086000, 18163427, 18174379, 18314489, 18339685, 18339868, 18343725, 18365547, 18381358, 18476949, 18490920, 18509748, 18521687, 18636206, 18639251, 18691092, 18707725, 18708754, 18829578, 18850011, 18854835, 18949419, 18978810, 19014607, 19016766, 19028277, 19066596, 19131542, 19148680, 19176399, 19177204, 19190516, 19223895, 19235921, 19240180, 19265129, 19291313, 19307182, 19344680, 19359588, 19423327, 19435875, 19443352, 19447872, 19449077, 19459851, 19483472, 19519293, 19568272, 19584228, 19671047, 19689405, 19696166, 19724277, 19724845, 19735869, 19782034, 19789218, 19808899, 19816521, 19845601, 19946328, 19962963, 20003295, 20026900, 20066420, 20080132, 20117921, 20151982, 20154618, 20184881, 20198320, 20206160, 20208561, 20213095, 20217131, 20234185, 20383692, 20398289, 20407014, 20414936, 20429620, 20442286, 20470445, 20513003, 20514449, 20515450, 20556833, 20566631, 20570889, 20572162, 20587661, 20599538, 20622897, 20624301, 20627616, 20637781, 20651398, 20656543, 20660313, 20668552, 20857420, 20961996, 20970309, 20977428, 20978507, 21037926, 21056497, 21059928, 21069338, 21085474, 21116837, 21140472, 21152246, 21266827, 21358671, 21364021, 21404119, 21415706, 21444629, 21460102, 21512133, 21552147, 21593792, 21630273, 21643985, 21660559, 21671859, 21693763, 21709439, 21778301, 21778785, 21812995, 21822544, 21843314, 21852384, 21892750, 21893035, 21896639, 21909688, 21917858, 21949677, 22006996, 22037472, 22040412, 22043993, 22094876, 22151618, 22170854, 22179285, 22190738, 22214851, 22248028, 22249030, 22305612, 22318330, 22350022, 22367210, 22417164, 22447412, 22472348, 22487528, 22524809, 22582814, 22684860, 22705278, 22820662, 22856603, 22890239, 22894905, 22901144, 22914908, 22923450, 22924580, 22925504, 22926525, 22926560, 22961911, 22977270, 23013270, 23023398, 23042446, 23071360, 23144690, 23160373, 23161568, 23178531, 23185562, 23201159, 23206445, 23225225, 23228632, 23228635, 23246962, 23257898, 23289374, 23315288, 23335244, 23342109, 23344526, 23348791, 23361277, 23381944, 23481210, 23528211, 23530113, 23545606, 23549264, 23551342, 23579072, 23584483, 23593116, 23633488, 23702609, 23706268, 23707522, 23712868, 23718763, 23748663, 23756865, 23804414, 23811286, 23840849, 23857282, 23880760, 23881929, 23886154, 23902561, 23924028, 23959856, 23977378, 23999440, 24067372, 24090974, 24133573, 24162827, 24163135, 24164895, 24189146, 24193262, 24214898, 24228093, 24242862, 24248265, 24286852, 24292632, 24321089, 24335623, 24336068, 24366912, 24374892, 24403227, 24413338, 24425105, 24457463, 24465590, 24486412, 24491031, 24509158, 24516257, 24561231, 24590840, 24599602, 24614362, 24651981, 24658058, 24662981, 24676840, 24722179, 24781871, 24797826, 24812272, 24853275, 24885595, 24895585, 24914051, 24916472, 24918449, 25061734, 25075425, 25091694, 25100134, 25119596, 25162518, 25179843, 25196648, 25222223, 25266796, 25275595, 25310734, 25316231, 25391657, 25412955, 25423275, 25440060, 25453096, 25467539, 25492865, 25520138, 25548487, 25564169, 25596085, 25596376, 25618442, 25733830, 25749383, 25778315, 25813354, 25824798, 25830305, 25849745, 25872924, 25884381, 25893706, 25915846, 25920936, 25939381, 25973951, 26026583, 26078356, 26083570, 26094772, 26115041, 26116902, 26214618, 26232272, 26267380, 26294080, 26297910, 26298207, 26329876, 26339797, 26376118, 26393682, 26406411, 26408684, 26462158, 26497365, 26528854, 26538165, 26589109, 26621849, 26625311, 26647838, 26657503, 26702059, 26711266, 26715642, 26719577, 26730155, 26745120, 26757928, 26771605, 26784107, 26806607, 26824423, 26825709, 26938486, 26984380, 27004522, 27013198, 27015631, 27098149, 27107327, 27144516, 27173353, 27253180, 27263528, 27307407, 27322147, 27345397, 27358011, 27440271, 27452367, 27482884, 27484627, 27507852, 27536856, 27589564, 27616748, 27693633, 27698264, 27743086, 27805252, 27838496, 27840318, 27840971, 27845047, 27862063, 27913861, 27990624, 28000883, 28012930, 28039264, 28045433, 28060746, 28068095, 28069592, 28092369, 28099149, 28102487, 28106050, 28123567, 28162286, 28165392, 28249000, 28255354, 28257457, 28268243, 28282584, 28285930, 28318896, 28322833, 28362240, 28383481, 28387640, 28401064, 28401339, 28410229, 28425505, 28426124, 28440460, 28449718, 28471448, 28521491, 28521842, 28522586, 28552779, 28554753, 28560067, 28569777, 28601635, 28619042, 28653878, 28656256, 28659004, 28684144, 28710377, 28737429, 28756482, 28762556, 28781970, 28790395, 28842332, 28885396, 28894274, 28952293, 28978924, 28985606, 28994107, 29032465, 29039125, 29084756, 29088755, 29097800, 29108235, 29113268, 29113799, 29117193, 29136509, 29150606, 29152120, 29162879, 29171040, 29247885, 29251629, 29254140, 29289560, 29306019, 29328439, 29330807, 29393454, 29416753, 29436645, 29439255, 29461122, 29487418, 29525633, 29532562, 29587825, 29654110, 29658569, 29693146, 29695399, 29716919, 29717265, 29724996, 29755400, 29807229, 29852266, 29854305, 29858032, 29872221, 29899167, 29914529, 29915361, 29917189, 29925335, 29938199, 30015895, 30035346, 30082910, 30087869, 30102510, 30108689, 30119998, 30128035, 30174456, 30178341, 30186230, 30214007, 30250643, 30272364, 30274686, 30292665, 30355300, 30367150, 30367454, 30372397, 30381462, 30389926, 30394322, 30396856, 30405819, 30412628, 30420976, 30431105, 30470736, 30485482, 30506278, 30513863, 30538116, 30539847, 30549360, 30555801, 30569877, 30605014, 30613298, 30648775, 30678221, 30678691, 30745829, 30755586, 30779072, 30781795, 30782242, 30784357, 30788427, 30789971, 30811976, 30819620, 30825027, 30881046, 30885992, 30902790, 30914315, 30922919, 30930461, 30943404, 30943919, 30951900, 31037150, 31043706, 31057297, 31083403, 31100311, 31106146, 31175269, 31175327, 31186690, 31186706, 31188068, 31192864, 31213919, 31268155, 31273053, 31293763, 31323773, 31350332, 31423208, 31496732, 31554283, 31569523, 31577739, 31585939, 31616157, 31622608, 31650167, 31657619, 31662796, 31678210, 31687671, 31695774, 31700144, 31705798, 31724069, 31729096, 31763809, 31811344, 31821370		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21910893, 27015631		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	24616092		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30840958		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	37478256	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	30672442		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12239177, 22363512, 23563563, 25630799, 25912138, 26057707, 27824082, 28590414, 29117193, 30808328, 35942521, 39632332	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	15252039		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15352172, 15930297, 16618748, 16985058, 17097563, 18645007, 20208561, 20961996, 21484514, 23395630, 23563563, 24201448, 24746828, 25148040, 25288151, 25339014, 25811359, 25912138, 26057707, 26458913, 28590414, 29032465, 29051813, 29117193, 30808328, 31048207, 31511046		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33383341	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22036844, 23131565, 23900566		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	24824755, 25833823, 28558056	Associate	★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	30862459		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31185507		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	31635898		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24402912, 28088462, 30242180, 31009107		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15709164, 15845181, 16532342, 16837101, 16929169, 19148680, 19190516, 19245702, 19305150, 20660313, 20822827, 21567203, 21724587, 22153809, 23059773, 23064377, 23591990, 23886154, 24022342, 24335195, 24403227, 24567056, 24793809, 25058399, 25162518, 25193384, 25748238, 26641474, 26931433, 27107327, 27132509, 27501049, 27553958, 28042952, 28426124, 28653893, 29115513, 29858032, 29898734, 29966011, 29971135, 30310502, 30381462, 30609861, 30642030, 30665327, 30680718, 30710412, 30797490, 30844110, 30881046, 31078152, 31169018, 31203382, 31205560, 31241217, 31298332, 31841190		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	30381462		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30102772, 30379980, 30668625		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	17685448, 23409121, 31192864, 31653758		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	CTD_human_DG	20526721		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16046292, 17591803, 20716529, 21386799, 22302938, 22546680, 24484739, 26619907, 27430909, 27738746, 29155477, 29935943, 30071127, 30208320, 30772502, 30828970, 30897274, 31220580		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17591803, 30409902, 30868903, 31935962, 33758342	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36961533	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	20716529		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1A	Oculocutaneous albinism	BEFREE	22432008		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	17099695	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	32723315	Stimulate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17140257, 25929338, 28351619, 29393454		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	37946484	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	24444256	Associate	★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	BEFREE	29791568		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	LHGDN	18221327		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	27743497, 28365254		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	28365254	Stimulate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	35381759, 36308177	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11465705	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12823854, 15987493, 22249478, 23965235, 26559024, 30081074, 32072994, 32572904, 33430025, 33629290, 35887269, 36281111	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31055848, 32476580	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	26293784, 39796139	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	30755787, 40211184	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	26293784, 28123469		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	23456821	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	28559999, 28979191, 29724989, 31257333		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	36496986	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	37324938	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	30711175		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	24023068, 28685750		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	24023068, 30257116		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29745905, 35069454, 36147560	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	24023068		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17310851, 20637078, 20845995, 21287578, 21360287, 22355351, 22736026, 23785417, 24333432, 24618817, 25384583, 25884381, 25893706, 26077139, 27072870, 27098149, 27662380, 27902314, 28045433, 28442599, 28534992, 28796315, 29207631, 29328452, 29637006, 29807229, 30278484, 30485482, 30506278, 30894277, 31228799, 31392931, 31448053		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17310851, 18528739		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	18528739, 24618817, 25884381, 27662380, 29328452, 29739381, 31866584, 31930127, 32802732, 35729160, 36438897, 38297292	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	30919059		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11804750, 19014607, 30912527		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	17532031, 21040214, 25756515, 30678691		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	15337760, 16294025, 26205780, 28348069	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11410504, 17498666, 17555795, 18498645, 19016748, 20398289, 23389731, 25174950, 25491408, 25756515, 25975373, 26548925, 26801746, 28401704, 28459376, 28878214, 29797601, 30867818, 31077234, 31175269, 31437208, 31587013, 31639424, 31700155, 31851935		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15474452, 16515634, 18476949		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12023962, 14507651, 15337760, 17110434, 19014607, 21964756, 22336585, 23437196, 23545606, 25491408, 25975373, 26261517, 26548925, 26801746, 27166196, 28401704, 28504421, 28678326, 28851888, 29482638, 29770329, 30217067, 30898838, 30912527, 30988076, 31077234, 31088908, 31437208, 31587013, 31887107, 32312328, 33673181, 34060285, 34065317, 34209278, 35733918, 36207479, 36599894, 37867353, 38195606	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17532031, 31175269	Stimulate	★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	30725321		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	20309614, 25072260		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	28660411		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12499918, 12651620, 16552335, 16628086, 16998831, 17312464, 17534684, 18509748, 18592007, 19080330, 19414389, 19417024, 19445542, 20556833, 20587661, 21709439, 21778785, 21922147, 22367292, 22472348, 22487528, 22825513, 22970168, 23377827, 23467940, 23485726, 23633488, 23924606, 23979441, 24008827, 24198204, 24367595, 24509158, 24561118, 24575976, 25385028, 25497868, 25573413, 25655308, 25853522, 26094625, 26497365, 26715642, 26785721, 27367674, 27566398, 28069592, 28697344, 28801636, 28810656, 28928287, 29038348, 29152137, 29396728, 29476053, 29702094, 29708271, 29758199, 30056064, 30455857, 30867721, 31100311, 31119050, 31239153, 31241439, 31367258, 31402756, 31410216, 31585939, 31638231		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20556833, 22899799, 24662981, 25314054, 25799412, 26872370, 28475017, 29330793, 30214007, 30922919, 31565190		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12651620, 14981919, 16278378, 16552335, 17143338, 18376310, 18422749, 18592007		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	16628086		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	18509748, 23633488, 23745588, 25119596, 26739387, 29330793, 29535824, 30676731		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12937141, 15558070, 17968710, 18592007, 18607542, 19414389, 19671674, 20037603, 21709439, 21887310, 22970168, 23377827, 23726431, 23740244, 24002598, 24008827, 24509158, 24513179, 24561986, 25119596, 25596110, 26232512, 26785721, 27367674, 28193910, 28475017, 28482827, 30863481, 31402756, 32185224, 32826949, 33749639, 34245303, 34511884, 34836938, 35088883, 35635094, 35789607, 36200682, 36369467, 36416348, 37149664, 37753069	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31584877	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	25888489	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29924990		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	25573413		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	19581925		★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma, sporadic	Papillary renal carcinoma	BEFREE	21281817		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	14991901, 22151618, 23688271, 23893334, 26846782, 30675128, 31378898		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	21266827, 30065361, 30718984		★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	32192527	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	16954163, 17520677, 23902947, 26492543, 28036268, 29126304, 30549360		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	23889685	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23900566, 26768367, 26818499, 29471019, 29755339, 31025220, 31292720, 31408200		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26768367, 36674945	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal Nonkinesigenic Dyskinesia 1	Paroxysmal nonkinesigenic dyskinesia	BEFREE	23424623		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29230415, 29578197, 30504760	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	29578197		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29654284		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	25861162, 31020669		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	27058371	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	25861162, 33231338	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27058371	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29446089, 31020669, 31800874		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	24657063, 29843956	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	20926496, 21947297, 24657063		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	21947297		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	16507742, 17150152		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	30598338		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	17094412	Stimulate	★☆☆☆☆ Found in Text Mining only
Persistent Hyperplastic Primary Vitreous	Persistent Hyperplastic Primary Vitreous	BEFREE	22665973		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	18599338		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	16954163, 17520677, 19228690, 19671538, 24676840, 28979191		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	LHGDN	16168127		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	24807638		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	21458987		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	30292665		★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	20526373		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30173898		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	30173898, 30348299, 31319406		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29115598, 31327131		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31327131, 32096549, 35528524, 36151730	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34360981	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	11987242, 29118187, 8982288		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	14521712, 31001558, 32755251, 34680921, 38244120	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28664719		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	22785211		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	22785211		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23289374, 26859780, 28546582		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	22271822		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	22271822		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	17617866	Associate	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	26408680		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	22271822		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	CTD_human_DG	22271822		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31408201		★☆☆☆☆ Found in Text Mining only
Propionic acidemia	Propionic acidemia	BEFREE	30753843		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	25884381	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11059752, 11980636, 12136249, 15538748, 16432534, 16678800, 16701010, 16954428, 16956360, 16998808, 17213816, 17237281, 17426252, 17562539, 17624927, 18240292, 18258605, 18398039, 18506761, 18563715, 19016246, 19096962, 19106642, 19211554, 19845601, 20564320, 20651983, 21037926, 21480310, 21500193, 21628883, 21649463, 21909688, 22083267, 22355351, 22505354, 22516347, 22537539, 22647679, 23042446, 23185615, 23342109, 23594994, 23723982, 23831623, 23870899, 23924028, 24035332, 24090974, 24435707, 24504474, 24599003, 24775564, 25349289, 26010887, 26096936, 26450901, 27448695, 28143503, 28165392, 28167510, 28415653, 28760843, 28790395, 28974155, 29137361, 29315957, 29492208, 29658569, 29708817, 29742803, 29760417, 29885835, 30174456, 30216369, 30357756, 30488478, 30531685, 30745829, 30837551, 31012989, 31364741, 31419966, 31771535, 31848297		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	19096962		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	22986049		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15156201		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12136249, 16083877, 17611019, 18359762, 19051213, 20470445, 20609350, 21480310, 23342109, 25896712, 27588494, 31848297		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12136249, 15538748, 16205110, 16278385, 16998808, 17426252, 17562539, 18240292, 18563715, 19016246, 19096962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12136249, 12401798, 15623945, 16205110, 16884534, 16886625, 18285700, 18563715, 18682687, 19101986, 19106642, 19151763, 19211554, 19244104, 20303950, 20385358, 20651983, 21179202, 21640519, 21731766, 21896985, 22038225, 22276222, 22390300, 22516347, 22546016, 22647679, 23042446, 23342109, 23487784, 23594994, 23831623, 23924028, 24090974, 24464861, 24504474, 24599003, 24837709, 24859886, 25072260, 25828575, 25829060, 25938433, 26010887, 26499200, 26944191, 27225200, 28760843, 29568752, 29708817, 30037119, 30216369, 30357756, 30837551, 31364741, 31500219, 31671779, 32215176, 33279858, 33605548, 33721728, 35328346, 36326314, 36364008, 36496973, 36536346, 36623445, 36629160, 37067635	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16205110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23977378, 27448695	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	22986049		★☆☆☆☆ Found in Text Mining only
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	28660411		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28110689, 30230035, 31148856		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	36961533	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	28803935, 28873177		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	29578197		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	18261897, 26071969, 27667582, 30266526, 30819028, 30982984, 31391533, 31488850		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21258008, 23509326, 36072642	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	27811062	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20562128, 22172637, 22383663	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21557221, 25565795, 26782374, 27163696, 28865600, 29339421, 30280794, 30538441, 30575333, 32099002, 33469280, 34258270, 35609226, 35634326, 35637927, 36217332, 36277008, 37838700, 38059012, 38214374	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29695901, 32921997	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	14555664	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	27210110, 31001558	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	37002243	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24040961, 28648907, 28965583		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17761615, 26022899, 26781174, 28446589, 28699703, 28701304, 28915065, 29467842, 29645000, 30560874		★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	29991707	Associate	★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	29991707		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20001759, 20117921, 20970309, 22199327, 24455740, 27127154, 27938946, 29103468, 31127991		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	11114720, 12459261, 14992692, 15821583, 21233420, 22012259, 22037472, 24332042		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11114720, 11526493, 12086861, 12459261, 12697836, 12853836, 14992692, 15220362, 15262424, 15350301, 15492789, 15964822, 16205110, 16261165, 16600797, 16920734, 17482131, 17699105, 18566226, 18949419, 19228690, 19483472, 19816521, 20032376, 20679884, 21275466, 21332301, 21778301, 21908555, 21949677, 22037472, 22286234, 22367210, 22517515, 22614155, 23298237, 24356968, 24367595, 24390735, 24916472, 24916699, 25100134, 25578041, 26021863, 26474388, 26620126, 26937175, 27029070, 27507852, 27583351, 27834463, 28110220, 28476527, 28492542, 28572533, 28851650, 29033184, 29938199, 30177838, 30528714, 30539853, 30555801, 31419966, 31496820, 31579115		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12697836, 12781449, 15217953, 15350301, 15709180, 15809750, 19061835		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23481058, 25406100, 25987665, 29352658, 30032308, 31239073, 31786195		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	22432008, 23481058, 25822459		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	29212519		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31121134		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	33951416	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	22977664, 28638274	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	16046581, 17869204, 17947829, 18208562, 18853324, 24533641, 24664750, 28289375, 29411894		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	24859386	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	28243027	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29295858, 31251468		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	20860824, 24338218, 29243776, 35253975, 36741966	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23804414, 24338218, 24860939, 25872572, 28962169, 29243776		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	23296045, 24533641, 26940670, 29411894, 31341109, 31564208		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	40084286	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17043658		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	29641463		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	29641463	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12823854		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17393418, 17893997, 19758219, 22960198, 23001847, 23711352, 23967327, 24525913, 25545169, 26141990, 26604208, 28901512, 29411043, 30030103, 30830763, 31401905, 31594926, 31794869		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	21517900		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	28051265, 37793334	Associate	★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	25301555, 28459801		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	28382782, 31518157		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	30902790		★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	18163427		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	23181555	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	26022899, 30946009		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	30946009	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	20026900, 22304008, 22684860, 22963500, 23906982, 25965573, 25973951, 28404817, 30513863		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	20026900, 24927770, 25965573, 30513863	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	20442286, 20637078, 23579072, 33682749	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	23221556, 26092770, 33789996, 37909728	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	35806119	Inhibit	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16632332		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	23096096		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	29991707	Stimulate	★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	22271822		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	18086000		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26917434, 35090526, 37047205	Associate	★☆☆☆☆ Found in Text Mining only
Septal hypertrophy	Septal Hypertrophy	BEFREE	23007030		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21307008, 25746953, 27515179, 28277320, 28665194, 28679957, 29530072, 30340459, 31049763, 31121134, 31555665		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	23344526		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	24840724, 28598679		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	24840724, 28051265	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	28484714	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	29064206		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	37526979	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30029761, 30292665, 31594926		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	18323789, 27798163, 29706348, 30230035		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	19276359		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	27754829, 29997451, 30669593, 32663129, 32896931	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30600310, 31116583, 33737411, 34667186, 39940739	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	34446064	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27754829, 28131740, 30656807, 30669593, 31116583, 31309463		★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	32939054	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	21843314, 25695729, 26750332, 28430666, 28824314, 30842147		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	20003295, 22258474, 23295589, 25695729, 28824314, 35641209	Associate	★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	31773182		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	25401740		★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	20526373		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	18030615, 18279708		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12966423, 16035955, 19096126		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15300796, 15709164, 16227395, 16412252, 19212630, 19235921, 19293442, 19374849, 20656543, 20807755, 21332579, 22113109, 23028863, 25564169, 25596376, 25723392, 27474170, 27616748, 28099149, 28459203, 28521842, 29185833, 29289482, 29399192, 29914529, 30458787, 31579115		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15771621, 20042640, 21519196, 22524809, 24561231, 25548487, 26310281, 28560067, 29885401, 29916308, 30904401, 31081089, 31233197		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	17201171		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15901372, 16035955, 16205110, 18630523, 19293442, 19568272, 20544685, 20622897, 22348829, 23028863, 23699668, 23920275, 24416312, 25421331, 25816356, 26640316, 27191981, 28099149, 28407653, 28468237, 29289482, 29695399, 29914529, 30402847, 30458787, 30718984, 31268159, 31740787, 32065407, 32238919, 32939054, 33639646, 34663515, 35381759, 36064348, 36450755, 36639776, 36748335, 37029804, 38256104, 38554317, 39382421	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26228921	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	30119998		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	23028863		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	17998062		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29662084		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12919954, 15492789, 16077932, 19762474, 20066420, 20622897, 22348829, 23340180, 23920275, 24035721, 24324073, 24436242, 25564169, 26245169, 28407653, 28881665, 28901527, 29163780, 29207062, 29592811, 29695399, 30240972, 30458787, 30987217, 31560860, 31813546		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	31268159		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	19293442, 21167768, 22552321, 25816356, 30402847		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28088462, 28843785, 29414684, 30102772, 30186489, 30242180		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	24927770, 26837714, 30513863		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15864753, 16847924, 17461470, 17953712, 18708754, 19048182, 19223895, 19504235, 20491781, 20559021, 21281785, 21779800, 22350022, 23023480, 24057269, 24165223, 24287180, 24927122, 25040744, 25761483, 26292288, 26329876, 26339797, 26406411, 26760764, 26793992, 26931435, 27016414, 27902480, 28819379, 28901473, 28978999, 29603227, 29737213, 29785022, 29899167, 29904245, 30093943, 30500418, 30705965, 30782242, 30851060, 31057297, 31222863, 31423208, 31673244		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28401064, 31001558	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	15199114, 19724845, 23970191, 31524232		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16338068, 16951228, 17461470, 17519536, 17984117, 18381294, 18452596		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17461470, 17519536, 17953712, 18381294, 18452596, 19223895, 19287200, 20491781, 20559021, 20706634, 20829524, 20845004, 22754381, 23364970, 23445622, 23569336, 23935399, 24614305, 24729089, 24764682, 24815301, 24927122, 25040744, 26292288, 26793992, 26931435, 27902480, 29904245, 29992789, 30556863, 30657557, 30988076, 31002130, 31222863, 31467922, 31673244, 31855733, 33773069, 35023280, 35151242, 35449150, 35499052, 35568711, 36128327, 36748372, 37108312, 38009671, 38175202, 39293524, 39674878	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29899167	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30226558, 31057297	Stimulate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	23408345, 26940670		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22167233, 32506171, 37324938	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	39969331	Stimulate	★☆☆☆☆ Found in Text Mining only
Sturge-Weber Syndrome	Sturge-Weber Syndrome	BEFREE	17204940		★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	CTD_human_DG	15341671		★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	BEFREE	21224066		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17034590, 19306159, 23096096, 28611671		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	21102525		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	35393474, 37689549	Associate	★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	19252526		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	22797143, 31422771		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	23032507, 23770788, 31422771, 34521346	Associate	★☆☆☆☆ Found in Text Mining only
Thiamine Deficiency	Thiamine Deficiency	BEFREE	29045486, 30008376		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	31116583		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	31263845	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	24294378, 26598923, 26910835	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	28474313	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	20473281, 24427353, 26846782, 31378898, 36329448, 36897686, 37198319, 39273308, 40598215	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	28474313		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	14602779, 19808899, 25862859, 27840971, 29084538, 30367082, 30768848		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	19808899		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27487122	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	29084538	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	19808899		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14602779, 25862859, 27840971, 30768848		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	19808899		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19808899, 23824493, 26756227, 29084538, 30367082, 30768848, 36428988, 37036874	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tongue Neoplasms	Tongue Neoplasms	LHGDN	19028277		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30678250		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	18000826		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition Of Great Vessels	BEFREE	20846364		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition of the great arteries	Pubtator	20846364	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21266827, 22801492, 22937154, 24248265, 24670641, 25356777, 25920936, 26046764, 26229077, 27137755, 27184798, 27303043, 27836733, 28039264, 28239645, 28978427, 29250173, 29880481, 29894296, 30346453, 30423844, 30827868, 31258644, 31455352, 31529195, 31577739, 31707383, 31817810		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22937154, 25356777, 27303043, 31577739, 33918859, 34779768, 34791795, 35338412, 35703312, 35867755, 35985176, 36822023, 36939902, 37681672, 37713894, 38081808, 38179762	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35268073	Stimulate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	17520677		★☆☆☆☆ Found in Text Mining only
Ulcer of esophagus	Ulcer Of Esophagus	BEFREE	22300081		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28282584, 29080614, 31814910		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	19808899		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	Pubtator	37773677	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary Bladder Diseases	BEFREE	30862459		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24737584, 24937673, 25266796, 26541358, 27542232, 27835695, 30315244, 30475758, 30786690, 32382009, 33681390, 33991457, 34080067, 36327483, 37813876, 40594164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	24737584		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19574782	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21213129, 21330825, 23927384, 24551277, 26464645, 27220494, 27492148, 27593081, 29207048, 29271989, 29654110, 30530968, 31350968, 32319576, 33099935, 33706793, 35069980, 35638109, 36028854, 37335690, 38257813, 39273054	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	36937462	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	28010141, 29779471		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	16826425, 20042655, 23077404, 26761211, 31323773, 31765784		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	25166211, 31765784	Associate	★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	28849201, 30474123, 31377879		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	22277691	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	20632821, 22277691, 26299356		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	20164116, 20498255		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	31089163, 34479471, 35666067	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	34479471	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	29626597	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34381164	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	37466160, 39969342	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Dysfunction Right	Ventricular dysfunction	Pubtator	31422771	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	30840126		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	30840126		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	23032507, 23492195, 23871585	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	31885781, 35222802	Stimulate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	10353251, 10944113, 11114720, 11156414, 11431362, 11772947, 15035285, 15220362, 15312748, 15824735, 15964822, 16261165, 16600797, 17189520, 19483472, 20221685, 21628883, 21778301, 24189146, 25310734, 25440060, 26037477, 26474388, 27482884, 28425505, 30790292		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	21910893	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	22467238		★☆☆☆☆ Found in Text Mining only