Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	309
Gene name	Annexin A6
Gene symbol	ANXA6
Synonyms (NCBI Gene)	ANX6CBP68CPB-IIp68p70
Chromosome	5
Chromosome location	5q33.1
Summary	Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approxi

155

Show/Hide all (155)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022347	hsa-miR-124-3p	Microarray	18668037
MIRT043164	hsa-miR-324-5p	CLASH	23622248
MIRT037148	hsa-miR-877-3p	CLASH	23622248
MIRT786577	hsa-miR-138	CLIP-seq
MIRT786578	hsa-miR-3155	CLIP-seq
MIRT786579	hsa-miR-3187-3p	CLIP-seq
MIRT786580	hsa-miR-3907	CLIP-seq
MIRT786581	hsa-miR-4435	CLIP-seq
MIRT786582	hsa-miR-4467	CLIP-seq
MIRT786583	hsa-miR-4529-5p	CLIP-seq
MIRT786584	hsa-miR-4701-5p	CLIP-seq
MIRT786585	hsa-miR-548q	CLIP-seq
MIRT786586	hsa-miR-548s	CLIP-seq
MIRT786587	hsa-miR-588	CLIP-seq
MIRT786588	hsa-miR-135a	CLIP-seq
MIRT786589	hsa-miR-135b	CLIP-seq
MIRT786590	hsa-miR-1538	CLIP-seq
MIRT786591	hsa-miR-1913	CLIP-seq
MIRT786592	hsa-miR-3127-3p	CLIP-seq
MIRT786593	hsa-miR-3157-5p	CLIP-seq
MIRT786594	hsa-miR-324-3p	CLIP-seq
MIRT786595	hsa-miR-3667-3p	CLIP-seq
MIRT786596	hsa-miR-3685	CLIP-seq
MIRT786597	hsa-miR-384	CLIP-seq
MIRT786598	hsa-miR-4257	CLIP-seq
MIRT786599	hsa-miR-4300	CLIP-seq
MIRT786600	hsa-miR-4481	CLIP-seq
MIRT786601	hsa-miR-4520a-3p	CLIP-seq
MIRT786602	hsa-miR-4699-5p	CLIP-seq
MIRT786603	hsa-miR-4745-3p	CLIP-seq
MIRT786604	hsa-miR-4745-5p	CLIP-seq
MIRT786605	hsa-miR-4749-3p	CLIP-seq
MIRT786606	hsa-miR-544b	CLIP-seq
MIRT786607	hsa-miR-920	CLIP-seq
MIRT786590	hsa-miR-1538	CLIP-seq
MIRT1932021	hsa-miR-296-5p	CLIP-seq
MIRT1932022	hsa-miR-3137	CLIP-seq
MIRT1932023	hsa-miR-3153	CLIP-seq
MIRT1932024	hsa-miR-3154	CLIP-seq
MIRT1932025	hsa-miR-320e	CLIP-seq
MIRT1932026	hsa-miR-3610	CLIP-seq
MIRT786598	hsa-miR-4257	CLIP-seq
MIRT1932027	hsa-miR-4293	CLIP-seq
MIRT786599	hsa-miR-4300	CLIP-seq
MIRT786600	hsa-miR-4481	CLIP-seq
MIRT1932028	hsa-miR-451b	CLIP-seq
MIRT1932029	hsa-miR-4646-5p	CLIP-seq
MIRT1932030	hsa-miR-4668-5p	CLIP-seq
MIRT1932031	hsa-miR-4731-5p	CLIP-seq
MIRT786603	hsa-miR-4745-3p	CLIP-seq
MIRT786604	hsa-miR-4745-5p	CLIP-seq
MIRT1932032	hsa-miR-4786-3p	CLIP-seq
MIRT1932033	hsa-miR-485-5p	CLIP-seq
MIRT786606	hsa-miR-544b	CLIP-seq
MIRT1932034	hsa-miR-548t	CLIP-seq
MIRT1932035	hsa-miR-671-5p	CLIP-seq
MIRT786607	hsa-miR-920	CLIP-seq
MIRT2172432	hsa-miR-1270	CLIP-seq
MIRT2172433	hsa-miR-1273f	CLIP-seq
MIRT2172434	hsa-miR-4683	CLIP-seq
MIRT2172435	hsa-miR-620	CLIP-seq
MIRT2172436	hsa-miR-1265	CLIP-seq
MIRT786598	hsa-miR-4257	CLIP-seq
MIRT2172437	hsa-miR-4272	CLIP-seq
MIRT2172438	hsa-miR-4307	CLIP-seq
MIRT2435397	hsa-miR-103b	CLIP-seq
MIRT2435398	hsa-miR-2467-3p	CLIP-seq
MIRT1932022	hsa-miR-3137	CLIP-seq
MIRT2435399	hsa-miR-3651	CLIP-seq
MIRT2435400	hsa-miR-4436b-3p	CLIP-seq
MIRT2435401	hsa-miR-4685-5p	CLIP-seq
MIRT1932033	hsa-miR-485-5p	CLIP-seq
MIRT2435397	hsa-miR-103b	CLIP-seq
MIRT2172436	hsa-miR-1265	CLIP-seq
MIRT2475360	hsa-miR-1324	CLIP-seq
MIRT786588	hsa-miR-135a	CLIP-seq
MIRT786589	hsa-miR-135b	CLIP-seq
MIRT786590	hsa-miR-1538	CLIP-seq
MIRT2435398	hsa-miR-2467-3p	CLIP-seq
MIRT1932021	hsa-miR-296-5p	CLIP-seq
MIRT2475361	hsa-miR-3117-5p	CLIP-seq
MIRT1932022	hsa-miR-3137	CLIP-seq
MIRT1932023	hsa-miR-3153	CLIP-seq
MIRT786593	hsa-miR-3157-5p	CLIP-seq
MIRT1932025	hsa-miR-320e	CLIP-seq
MIRT1932026	hsa-miR-3610	CLIP-seq
MIRT2475362	hsa-miR-3612	CLIP-seq
MIRT2435399	hsa-miR-3651	CLIP-seq
MIRT2475363	hsa-miR-3660	CLIP-seq
MIRT786598	hsa-miR-4257	CLIP-seq
MIRT1932027	hsa-miR-4293	CLIP-seq
MIRT786599	hsa-miR-4300	CLIP-seq
MIRT2172438	hsa-miR-4307	CLIP-seq
MIRT2435400	hsa-miR-4436b-3p	CLIP-seq
MIRT786600	hsa-miR-4481	CLIP-seq
MIRT1932028	hsa-miR-451b	CLIP-seq
MIRT786601	hsa-miR-4520a-3p	CLIP-seq
MIRT2475364	hsa-miR-4526	CLIP-seq
MIRT1932029	hsa-miR-4646-5p	CLIP-seq
MIRT1932030	hsa-miR-4668-5p	CLIP-seq
MIRT2435401	hsa-miR-4685-5p	CLIP-seq
MIRT1932031	hsa-miR-4731-5p	CLIP-seq
MIRT786603	hsa-miR-4745-3p	CLIP-seq
MIRT786604	hsa-miR-4745-5p	CLIP-seq
MIRT1932033	hsa-miR-485-5p	CLIP-seq
MIRT786606	hsa-miR-544b	CLIP-seq
MIRT2475365	hsa-miR-650	CLIP-seq
MIRT2475366	hsa-miR-651	CLIP-seq
MIRT786607	hsa-miR-920	CLIP-seq
MIRT2435397	hsa-miR-103b	CLIP-seq
MIRT2172436	hsa-miR-1265	CLIP-seq
MIRT2475360	hsa-miR-1324	CLIP-seq
MIRT786588	hsa-miR-135a	CLIP-seq
MIRT786589	hsa-miR-135b	CLIP-seq
MIRT786590	hsa-miR-1538	CLIP-seq
MIRT2435398	hsa-miR-2467-3p	CLIP-seq
MIRT1932021	hsa-miR-296-5p	CLIP-seq
MIRT2475361	hsa-miR-3117-5p	CLIP-seq
MIRT786592	hsa-miR-3127-3p	CLIP-seq
MIRT1932022	hsa-miR-3137	CLIP-seq
MIRT1932023	hsa-miR-3153	CLIP-seq
MIRT786593	hsa-miR-3157-5p	CLIP-seq
MIRT1932025	hsa-miR-320e	CLIP-seq
MIRT1932026	hsa-miR-3610	CLIP-seq
MIRT2475362	hsa-miR-3612	CLIP-seq
MIRT2435399	hsa-miR-3651	CLIP-seq
MIRT2475363	hsa-miR-3660	CLIP-seq
MIRT786595	hsa-miR-3667-3p	CLIP-seq
MIRT786596	hsa-miR-3685	CLIP-seq
MIRT786597	hsa-miR-384	CLIP-seq
MIRT786598	hsa-miR-4257	CLIP-seq
MIRT1932027	hsa-miR-4293	CLIP-seq
MIRT786599	hsa-miR-4300	CLIP-seq
MIRT2172438	hsa-miR-4307	CLIP-seq
MIRT2435400	hsa-miR-4436b-3p	CLIP-seq
MIRT2675076	hsa-miR-4474-5p	CLIP-seq
MIRT786600	hsa-miR-4481	CLIP-seq
MIRT1932028	hsa-miR-451b	CLIP-seq
MIRT786601	hsa-miR-4520a-3p	CLIP-seq
MIRT2475364	hsa-miR-4526	CLIP-seq
MIRT1932029	hsa-miR-4646-5p	CLIP-seq
MIRT1932030	hsa-miR-4668-5p	CLIP-seq
MIRT2435401	hsa-miR-4685-5p	CLIP-seq
MIRT786602	hsa-miR-4699-5p	CLIP-seq
MIRT1932031	hsa-miR-4731-5p	CLIP-seq
MIRT786603	hsa-miR-4745-3p	CLIP-seq
MIRT786604	hsa-miR-4745-5p	CLIP-seq
MIRT786605	hsa-miR-4749-3p	CLIP-seq
MIRT1932033	hsa-miR-485-5p	CLIP-seq
MIRT2675077	hsa-miR-516b	CLIP-seq
MIRT786606	hsa-miR-544b	CLIP-seq
MIRT2675078	hsa-miR-593	CLIP-seq
MIRT2475365	hsa-miR-650	CLIP-seq
MIRT2475366	hsa-miR-651	CLIP-seq
MIRT786607	hsa-miR-920	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	15576473, 29636414, 32296183, 35063084
GO:0005525	Function	GTP binding	IMP	16605264
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	2138016
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005765	Component	Lysosomal membrane	IDA	23360953
GO:0005886	Component	Plasma membrane	IBA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006816	Process	Calcium ion transport	IBA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006937	Process	Regulation of muscle contraction	IEA
GO:0008289	Function	Lipid binding	IMP	16605264
GO:0012506	Component	Vesicle membrane	IBA
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	IMP	16605264
GO:0015485	Function	Cholesterol binding	IDA	23360953
GO:0016020	Component	Membrane	HDA	19946888
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28344315, 28675934
GO:0031902	Component	Late endosome membrane	IDA	23360953
GO:0034220	Process	Monoatomic ion transmembrane transport	IMP	16605264
GO:0042470	Component	Melanosome	IEA
GO:0042802	Function	Identical protein binding	IPI	16605264
GO:0048306	Function	Calcium-dependent protein binding	IPI	15226301
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051283	Process	Negative regulation of sequestering of calcium ion	IBA
GO:0051560	Process	Mitochondrial calcium ion homeostasis	IBA
GO:0051560	Process	Mitochondrial calcium ion homeostasis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 21362503, 23533145
GO:0097190	Process	Apoptotic signaling pathway	IBA
GO:0097190	Process	Apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
114070	544	ENSG00000197043

P08133

Protein name

Annexin A6 (67 kDa calelectrin) (Annexin VI) (Annexin-6) (Calphobindin-II) (CPB-II) (Chromobindin-20) (Lipocortin VI) (Protein III) (p68) (p70)

Protein function

May associate with CD21. May regulate the release of Ca(2+) from intracellular stores.

PDB

1M9I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00191	Annexin	24 → 89	Annexin	Family
PF00191	Annexin	96 → 161	Annexin	Family
PF00191	Annexin	179 → 245	Annexin	Family
PF00191	Annexin	255 → 320	Annexin	Family
PF00191	Annexin	367 → 432	Annexin	Family
PF00191	Annexin	439 → 504	Annexin	Family
PF00191	Annexin	524 → 593	Annexin	Family
PF00191	Annexin	603 → 668	Annexin	Family

Sequence

MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQ
SYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILA
SRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQD
VQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEK
LMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKS
LYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVARVELKGTVRPA
NDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKED
YHKSLEDALSSDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK
TSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNK
PLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGD
FLKALLALCGGED

Sequence length

673

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (117)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	30734961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	9878560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22286903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	31784980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	30694461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28165114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28851315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22984424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	28369848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19648476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	7501973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	1697098		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21861134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15083183, 19718048, 21185831, 21766210, 24131622, 25499975, 30417346, 30598531, 30719209, 30796030, 31173106, 7501973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21185831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24354805	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25193855, 27191261, 31747122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27711126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31063769, 31350168		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29434913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	29434913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17699760, 23349811, 25745998, 27941883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31784980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	9515022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27840968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28286740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29921656, 9756640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29274665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	25574825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25574825, 29274665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29294366, 30260594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15653324, 19322030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29178617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25574825, 29274665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27334756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	7501973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27334756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22810421, 30387548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	9515022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	23938603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	7718889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30110341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	19900398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36230969	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8656012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	23938603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29274665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	7501973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30234607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27334756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	2466842, 8464876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	2466842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	2466842, 8464876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10525320, 12472178, 2466842, 26202167, 8464876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	2466842, 8464876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	12045200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	34791836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15083183, 19718048, 21185831, 21766210, 24131622, 24626184, 25499975, 30417346, 30598531, 30719209, 30796030, 31173106, 7501973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24089522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25193855, 27191261, 31747122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28881357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18482004, 18829551, 23349811, 24739041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28279065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15972854, 21345143, 22415314, 28060548, 28465372, 28714416, 28881357, 29434913, 29729328, 29988738, 30417346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29434913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17699760, 23349811, 25745998, 27941883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19995069, 20663877, 25499975, 30719209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	8037214		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	8752144		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy	Muscular dystrophy	BEFREE	29065150, 31545299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	26080402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19900398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11753651, 12045200, 17699760, 19718048, 22415314, 22810421, 24354805, 27334756, 28557706, 28782555, 28881357, 29263213, 30590459, 30719209, 8752144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	19900398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	25485873, 31836699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27334756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19322030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31212828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40616392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	31747122		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25193855, 27191261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31474227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28881357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	16837594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27046189, 27846214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	2308937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18482004, 18829551, 23349811, 24739041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20953187, 23541940, 25574825		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	25574825	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27840968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27896842, 9756640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	34371826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28902714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	32977850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29526493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	9856816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22286903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16827128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27334756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	23938603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	BEFREE	22805177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	26209830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28279065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28279065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30590459, 30719209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30590459, 34238922, 36230969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	15653324		★★★★★ ★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	BEFREE	12045200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	8617775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32420368, 33184436, 36761744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21119665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	26586929	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ANXA6 (annexin A6)