Gene Gene information from NCBI Gene database.
Entrez ID 3087
Gene name Hematopoietically expressed homeobox
Gene symbol HHEX
Synonyms (NCBI Gene)
HEXHMPHHOX11L-PENPRHPRHX
Chromosome 10
Chromosome location 10q23.33
Summary This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [
miRNA miRNA information provided by mirtarbase database.
19
miRTarBase ID miRNA Experiments Reference
MIRT020132 hsa-miR-130b-3p Sequencing 20371350
MIRT031099 hsa-miR-19b-3p Sequencing 20371350
MIRT1045002 hsa-miR-130a CLIP-seq
MIRT1045003 hsa-miR-130b CLIP-seq
MIRT1045004 hsa-miR-19a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
51
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IC 18713067
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10871399, 15016828
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 18755198
GO:0000976 Function Transcription cis-regulatory region binding TAS 19324893
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604420 4901 ENSG00000152804
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q03014
Protein name Hematopoietically-expressed homeobox protein HHEX (Homeobox protein HEX) (Homeobox protein PRH) (Proline-rich homeodomain protein)
Protein function Recognizes the DNA sequence 5'-ATTAA-3' (By similarity). Transcriptional repressor (By similarity). Activator of WNT-mediated transcription in conjunction with CTNNB1 (PubMed:20028982). Establishes anterior identity at two levels; acts early to
PDB 2E1O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 138 194 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Liver and promyelocytic leukemia cell line HL-60. {ECO:0000269|PubMed:1360645, ECO:0000269|PubMed:8096636, ECO:0000269|PubMed:8103988}.
Sequence
MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTS
LVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPL
GKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ
VKTWFQNRRAKWRR
LKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSP
ASQEDLESEISEDSDQEVDIEGDKSYFNAG
Sequence length 270
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Maturity onset diabetes of the young
Transcriptional misregulation in cancer
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
23
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKYLOSING SPONDYLITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal dominant polycystic liver disease Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 27052408
★☆☆☆☆
Found in Text Mining only
Acute Undifferentiated Leukemia Leukemia BEFREE 29453249
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 20724036, 23036584, 26173052 Associate
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease, Late Onset Alzheimer disease BEFREE 15024728, 20724036
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 16584511
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 28712091 Associate
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis Pubtator 24371822 Associate
★☆☆☆☆
Found in Text Mining only
Benign Prostatic Hyperplasia Benign Prostatic Hyperplasia BEFREE 28134934
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 16854221, 28604763, 30457165
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma CTD_human_DG 16854221
★☆☆☆☆
Found in Text Mining only