Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	30835
Gene name	CD209 molecule
Gene symbol	CD209
Synonyms (NCBI Gene)	CDSIGNCLEC4LDC-SIGNDC-SIGN1hDC-SIGN
Chromosome	19
Chromosome location	19p13.2
Summary	This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including leprosy and tuberculosis mycobacteria,

225

Show/Hide all (225)

miRTarBase ID	miRNA	Experiments	Reference
MIRT723868	hsa-miR-3662	HITS-CLIP	19536157
MIRT723867	hsa-miR-1252-3p	HITS-CLIP	19536157
MIRT723866	hsa-miR-596	HITS-CLIP	19536157
MIRT723865	hsa-miR-556-5p	HITS-CLIP	19536157
MIRT723864	hsa-miR-4698	HITS-CLIP	19536157
MIRT664319	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT723863	hsa-miR-3670	HITS-CLIP	19536157
MIRT723862	hsa-miR-548aj-5p	HITS-CLIP	19536157
MIRT723861	hsa-miR-548f-5p	HITS-CLIP	19536157
MIRT723860	hsa-miR-548g-5p	HITS-CLIP	19536157
MIRT723859	hsa-miR-548x-5p	HITS-CLIP	19536157
MIRT723858	hsa-miR-1468-3p	HITS-CLIP	19536157
MIRT664311	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT664310	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT723857	hsa-miR-548aw	HITS-CLIP	19536157
MIRT695278	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT695277	hsa-miR-4636	HITS-CLIP	23313552
MIRT695276	hsa-miR-3929	HITS-CLIP	23313552
MIRT695275	hsa-miR-4419b	HITS-CLIP	23313552
MIRT695274	hsa-miR-4478	HITS-CLIP	23313552
MIRT695273	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT695272	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT695271	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT695270	hsa-miR-1827	HITS-CLIP	23313552
MIRT695269	hsa-miR-3975	HITS-CLIP	23313552
MIRT695268	hsa-miR-2467-5p	HITS-CLIP	23313552
MIRT695267	hsa-miR-3188	HITS-CLIP	23313552
MIRT695265	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT695266	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT695264	hsa-miR-4316	HITS-CLIP	23313552
MIRT664324	hsa-miR-3667-5p	HITS-CLIP	23824327
MIRT664323	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT664322	hsa-miR-451b	HITS-CLIP	23824327
MIRT664321	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT664320	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT664319	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT664318	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT664317	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT664316	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT664315	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT664313	hsa-miR-4696	HITS-CLIP	23824327
MIRT664314	hsa-miR-4252	HITS-CLIP	23824327
MIRT664312	hsa-miR-1273a	HITS-CLIP	23824327
MIRT664311	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT664310	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT664309	hsa-miR-7703	HITS-CLIP	23824327
MIRT723868	hsa-miR-3662	HITS-CLIP	19536157
MIRT723867	hsa-miR-1252-3p	HITS-CLIP	19536157
MIRT723866	hsa-miR-596	HITS-CLIP	19536157
MIRT723865	hsa-miR-556-5p	HITS-CLIP	19536157
MIRT723864	hsa-miR-4698	HITS-CLIP	19536157
MIRT664319	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT723863	hsa-miR-3670	HITS-CLIP	19536157
MIRT723862	hsa-miR-548aj-5p	HITS-CLIP	19536157
MIRT723861	hsa-miR-548f-5p	HITS-CLIP	19536157
MIRT723860	hsa-miR-548g-5p	HITS-CLIP	19536157
MIRT723859	hsa-miR-548x-5p	HITS-CLIP	19536157
MIRT723858	hsa-miR-1468-3p	HITS-CLIP	19536157
MIRT664311	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT664310	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT723857	hsa-miR-548aw	HITS-CLIP	19536157
MIRT695278	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT695277	hsa-miR-4636	HITS-CLIP	23313552
MIRT695276	hsa-miR-3929	HITS-CLIP	23313552
MIRT695275	hsa-miR-4419b	HITS-CLIP	23313552
MIRT695274	hsa-miR-4478	HITS-CLIP	23313552
MIRT695273	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT695272	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT695271	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT695270	hsa-miR-1827	HITS-CLIP	23313552
MIRT695269	hsa-miR-3975	HITS-CLIP	23313552
MIRT695268	hsa-miR-2467-5p	HITS-CLIP	23313552
MIRT695267	hsa-miR-3188	HITS-CLIP	23313552
MIRT695265	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT695266	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT695264	hsa-miR-4316	HITS-CLIP	23313552
MIRT664324	hsa-miR-3667-5p	HITS-CLIP	23824327
MIRT664323	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT664322	hsa-miR-451b	HITS-CLIP	23824327
MIRT664321	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT664320	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT664319	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT664318	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT664317	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT664316	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT664315	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT664313	hsa-miR-4696	HITS-CLIP	23824327
MIRT664314	hsa-miR-4252	HITS-CLIP	23824327
MIRT664312	hsa-miR-1273a	HITS-CLIP	23824327
MIRT664311	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT664310	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT664309	hsa-miR-7703	HITS-CLIP	23824327
MIRT874084	hsa-miR-1228	CLIP-seq
MIRT874085	hsa-miR-1254	CLIP-seq
MIRT874086	hsa-miR-24	CLIP-seq
MIRT874087	hsa-miR-3116	CLIP-seq
MIRT874088	hsa-miR-3200-5p	CLIP-seq
MIRT874089	hsa-miR-342-3p	CLIP-seq
MIRT874090	hsa-miR-4254	CLIP-seq
MIRT874091	hsa-miR-4284	CLIP-seq
MIRT874092	hsa-miR-4293	CLIP-seq
MIRT874093	hsa-miR-4717-5p	CLIP-seq
MIRT874094	hsa-miR-4755-3p	CLIP-seq
MIRT874095	hsa-miR-1252	CLIP-seq
MIRT874085	hsa-miR-1254	CLIP-seq
MIRT874096	hsa-miR-186	CLIP-seq
MIRT874097	hsa-miR-2467-3p	CLIP-seq
MIRT874087	hsa-miR-3116	CLIP-seq
MIRT874098	hsa-miR-3133	CLIP-seq
MIRT874099	hsa-miR-3173-3p	CLIP-seq
MIRT874100	hsa-miR-3612	CLIP-seq
MIRT874101	hsa-miR-3614-3p	CLIP-seq
MIRT874102	hsa-miR-3660	CLIP-seq
MIRT874090	hsa-miR-4254	CLIP-seq
MIRT874103	hsa-miR-4257	CLIP-seq
MIRT874104	hsa-miR-4509	CLIP-seq
MIRT874105	hsa-miR-4526	CLIP-seq
MIRT874106	hsa-miR-4744	CLIP-seq
MIRT874107	hsa-miR-4799-5p	CLIP-seq
MIRT874108	hsa-miR-650	CLIP-seq
MIRT874109	hsa-miR-1290	CLIP-seq
MIRT874110	hsa-miR-3167	CLIP-seq
MIRT874111	hsa-miR-3942-3p	CLIP-seq
MIRT874112	hsa-miR-490-5p	CLIP-seq
MIRT874113	hsa-miR-759	CLIP-seq
MIRT874114	hsa-miR-876-5p	CLIP-seq
MIRT874085	hsa-miR-1254	CLIP-seq
MIRT874115	hsa-miR-1972	CLIP-seq
MIRT874116	hsa-miR-203	CLIP-seq
MIRT874086	hsa-miR-24	CLIP-seq
MIRT874097	hsa-miR-2467-3p	CLIP-seq
MIRT874087	hsa-miR-3116	CLIP-seq
MIRT874117	hsa-miR-3122	CLIP-seq
MIRT874118	hsa-miR-3125	CLIP-seq
MIRT874119	hsa-miR-3178	CLIP-seq
MIRT874120	hsa-miR-3185	CLIP-seq
MIRT874121	hsa-miR-34b	CLIP-seq
MIRT874100	hsa-miR-3612	CLIP-seq
MIRT874122	hsa-miR-3689a-3p	CLIP-seq
MIRT874123	hsa-miR-3689c	CLIP-seq
MIRT874124	hsa-miR-3913-5p	CLIP-seq
MIRT874125	hsa-miR-3916	CLIP-seq
MIRT874126	hsa-miR-3920	CLIP-seq
MIRT874090	hsa-miR-4254	CLIP-seq
MIRT874103	hsa-miR-4257	CLIP-seq
MIRT874091	hsa-miR-4284	CLIP-seq
MIRT874127	hsa-miR-4437	CLIP-seq
MIRT874128	hsa-miR-4463	CLIP-seq
MIRT874129	hsa-miR-4480	CLIP-seq
MIRT874130	hsa-miR-4486	CLIP-seq
MIRT874131	hsa-miR-4650-5p	CLIP-seq
MIRT874132	hsa-miR-4660	CLIP-seq
MIRT874133	hsa-miR-4728-5p	CLIP-seq
MIRT874134	hsa-miR-509-3p	CLIP-seq
MIRT874135	hsa-miR-646	CLIP-seq
MIRT874108	hsa-miR-650	CLIP-seq
MIRT874086	hsa-miR-24	CLIP-seq
MIRT874091	hsa-miR-4284	CLIP-seq
MIRT2196227	hsa-miR-1273	CLIP-seq
MIRT2196228	hsa-miR-1273c	CLIP-seq
MIRT2196229	hsa-miR-1286	CLIP-seq
MIRT2196230	hsa-miR-183	CLIP-seq
MIRT874097	hsa-miR-2467-3p	CLIP-seq
MIRT2196231	hsa-miR-3180-5p	CLIP-seq
MIRT874088	hsa-miR-3200-5p	CLIP-seq
MIRT874121	hsa-miR-34b	CLIP-seq
MIRT874100	hsa-miR-3612	CLIP-seq
MIRT2196232	hsa-miR-3919	CLIP-seq
MIRT874103	hsa-miR-4257	CLIP-seq
MIRT2196233	hsa-miR-4276	CLIP-seq
MIRT874092	hsa-miR-4293	CLIP-seq
MIRT2196234	hsa-miR-4302	CLIP-seq
MIRT2196235	hsa-miR-505	CLIP-seq
MIRT2196236	hsa-miR-520a-5p	CLIP-seq
MIRT2196237	hsa-miR-525-5p	CLIP-seq
MIRT2196238	hsa-miR-548n	CLIP-seq
MIRT874108	hsa-miR-650	CLIP-seq
MIRT2196239	hsa-miR-653	CLIP-seq
MIRT2196240	hsa-miR-766	CLIP-seq
MIRT874097	hsa-miR-2467-3p	CLIP-seq
MIRT874085	hsa-miR-1254	CLIP-seq
MIRT874087	hsa-miR-3116	CLIP-seq
MIRT874090	hsa-miR-4254	CLIP-seq
MIRT874085	hsa-miR-1254	CLIP-seq
MIRT2196227	hsa-miR-1273	CLIP-seq
MIRT874115	hsa-miR-1972	CLIP-seq
MIRT874097	hsa-miR-2467-3p	CLIP-seq
MIRT2499249	hsa-miR-300	CLIP-seq
MIRT874087	hsa-miR-3116	CLIP-seq
MIRT874117	hsa-miR-3122	CLIP-seq
MIRT874121	hsa-miR-34b	CLIP-seq
MIRT874100	hsa-miR-3612	CLIP-seq
MIRT2499250	hsa-miR-3613-3p	CLIP-seq
MIRT874122	hsa-miR-3689a-3p	CLIP-seq
MIRT874123	hsa-miR-3689c	CLIP-seq
MIRT2499251	hsa-miR-381	CLIP-seq
MIRT2499252	hsa-miR-384	CLIP-seq
MIRT874124	hsa-miR-3913-5p	CLIP-seq
MIRT874090	hsa-miR-4254	CLIP-seq
MIRT874103	hsa-miR-4257	CLIP-seq
MIRT874131	hsa-miR-4650-5p	CLIP-seq
MIRT2499253	hsa-miR-4684-5p	CLIP-seq
MIRT2499254	hsa-miR-4709-5p	CLIP-seq
MIRT874133	hsa-miR-4728-5p	CLIP-seq
MIRT2499255	hsa-miR-4738-3p	CLIP-seq
MIRT2499256	hsa-miR-548c-3p	CLIP-seq
MIRT874108	hsa-miR-650	CLIP-seq
MIRT2196240	hsa-miR-766	CLIP-seq
MIRT874085	hsa-miR-1254	CLIP-seq
MIRT2196227	hsa-miR-1273	CLIP-seq
MIRT874097	hsa-miR-2467-3p	CLIP-seq
MIRT2499249	hsa-miR-300	CLIP-seq
MIRT874087	hsa-miR-3116	CLIP-seq
MIRT874121	hsa-miR-34b	CLIP-seq
MIRT874100	hsa-miR-3612	CLIP-seq
MIRT2499250	hsa-miR-3613-3p	CLIP-seq
MIRT2499251	hsa-miR-381	CLIP-seq
MIRT2499252	hsa-miR-384	CLIP-seq
MIRT874090	hsa-miR-4254	CLIP-seq
MIRT874103	hsa-miR-4257	CLIP-seq
MIRT2499253	hsa-miR-4684-5p	CLIP-seq
MIRT2499254	hsa-miR-4709-5p	CLIP-seq
MIRT2499256	hsa-miR-548c-3p	CLIP-seq
MIRT874108	hsa-miR-650	CLIP-seq
MIRT2196240	hsa-miR-766	CLIP-seq

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	22156524, 24623090
GO:0001618	Function	Virus receptor activity	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	12609975, 16246332, 16282604, 25416956, 29892012, 32296183, 32766577, 32814053, 32915505, 34015061, 34341769
GO:0005537	Function	D-mannose binding	IBA
GO:0005537	Function	D-mannose binding	IEA
GO:0005537	Function	D-mannose binding	TAS	1518869
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	NAS	11337487
GO:0005886	Component	Plasma membrane	IDA	12421943
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006897	Process	Endocytosis	IEA
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	1518869
GO:0007159	Process	Leukocyte cell-cell adhesion	NAS	11337487
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	24942581
GO:0009986	Component	Cell surface	HDA	23981064
GO:0009988	Process	Cell-cell recognition	IEA
GO:0009988	Process	Cell-cell recognition	TAS	11337487
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	1518869
GO:0019062	Process	Virion attachment to host cell	IEA
GO:0019062	Process	Virion attachment to host cell	TAS	11337487
GO:0019079	Process	Viral genome replication	NAS	11337487
GO:0019882	Process	Antigen processing and presentation	NAS	11337487
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	NAS	11337487
GO:0035556	Process	Intracellular signal transduction	NAS	11337487
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	12421943
GO:0042129	Process	Regulation of T cell proliferation	IDA	12456590
GO:0042605	Function	Peptide antigen binding	NAS	11337487
GO:0043657	Component	Host cell	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046718	Process	Symbiont entry into host cell	IDA	24623090
GO:0046790	Function	Virion binding	IEA
GO:0046790	Function	Virion binding	TAS	11337487
GO:0046872	Function	Metal ion binding	IEA
GO:0046968	Process	Peptide antigen transport	NAS	11337487
GO:0075733	Process	Intracellular transport of virus	IEA
GO:0075733	Process	Intracellular transport of virus	TAS	11337487
GO:0097323	Process	B cell adhesion	IDA	12421943
GO:1903902	Process	Positive regulation of viral life cycle	IMP	22673088

MIM	HGNC	e!Ensembl
604672	1641	ENSG00000090659

Q9NNX6

Protein name

CD209 antigen (C-type lectin domain family 4 member L) (Dendritic cell-specific ICAM-3-grabbing non-integrin 1) (DC-SIGN) (DC-SIGN1) (CD antigen CD209)

Protein function

Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartm

PDB

1K9I , 1SL4 , 1SL5 , 2B6B , 2IT5 , 2IT6 , 2XR5 , 2XR6 , 6GHV , 7NL6 , 7NL7 , 9EMQ , 9EMR , 9EMS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	273 → 379	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes. {ECO:0000269|PubMed:

Sequence

MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQV
SKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKL
QEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAV
GELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQ
ELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQ
NFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFS
GNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Sequence length

404

Interactions

View interactions

	KEGG		Reactome
	Virion - Human immunodeficiency virus Virion - Flavivirus and Alphavirus Virion - Ebolavirus, Lyssavirus and Morbillivirus Virion - Lassa virus and SFTS virus Phagosome C-type lectin receptor signaling pathway Tuberculosis Measles		CD209 (DC-SIGN) signaling Butyrophilin (BTN) family interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CD209-related disorder	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dengue fever, protection against	protective; risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dengue virus, susceptibility to	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mycobacterium tuberculosis, susceptibility to	protective; risk factor; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to HIV infection	protective; risk factor; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (65)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia Sickle Cell	Sickle cell anemia	Pubtator	29100978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28377641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	35095831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	21526507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	35095831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12571844, 21953583, 24023637, 33792986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24023637	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35095831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21988460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28607410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28377641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33380678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21703422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16865785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	16865785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	16865785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18070336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24347371	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21515679, 23650115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18292560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21515679, 23298232, 25504222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Congenital hemidysplasia with ichthyosiform erythroderma and limb defects	Pubtator	22808239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21703422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	12594843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12594843, 19095953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18070336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	20829290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25092567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	18368027, 22133869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24594345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33925174	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	11799126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18070336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18070336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18371209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	16698431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	20713631, 35703715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18354176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	16641270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	14693842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	26568320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34424958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20937880, 26194765, 26272216, 34083646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21067616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25885805, 36353633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26438868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	22629172, 25148534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	25148534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	24610622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35283406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21067616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21067616, 23576520, 28694559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23576520	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21703422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29342940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	19264667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	33029540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37435060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21703422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	15494514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19567623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	LHGDN	17715238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	20359516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18070336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18070336		★★★★★ ★☆☆☆☆ Found in Text Mining only

CD209 (CD209 molecule)