Gene Gene information from NCBI Gene database.
Entrez ID 30835
Gene name CD209 molecule
Gene symbol CD209
Synonyms (NCBI Gene)
CDSIGNCLEC4LDC-SIGNDC-SIGN1hDC-SIGN
Chromosome 19
Chromosome location 19p13.2
Summary This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including leprosy and tuberculosis mycobacteria,
miRNA miRNA information provided by mirtarbase database.
225
miRTarBase ID miRNA Experiments Reference
MIRT723868 hsa-miR-3662 HITS-CLIP 19536157
MIRT723867 hsa-miR-1252-3p HITS-CLIP 19536157
MIRT723866 hsa-miR-596 HITS-CLIP 19536157
MIRT723865 hsa-miR-556-5p HITS-CLIP 19536157
MIRT723864 hsa-miR-4698 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
47
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IDA 22156524, 24623090
GO:0001618 Function Virus receptor activity IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 12609975, 16246332, 16282604, 25416956, 29892012, 32296183, 32766577, 32814053, 32915505, 34015061, 34341769
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604672 1641 ENSG00000090659
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NNX6
Protein name CD209 antigen (C-type lectin domain family 4 member L) (Dendritic cell-specific ICAM-3-grabbing non-integrin 1) (DC-SIGN) (DC-SIGN1) (CD antigen CD209)
Protein function Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartm
PDB 1K9I , 1SL4 , 1SL5 , 2B6B , 2IT5 , 2IT6 , 2XR5 , 2XR6 , 6GHV , 7NL6 , 7NL7 , 9EMQ , 9EMR , 9EMS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 273 379 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes. {ECO:0000269|PubMed:
Sequence
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQV
SKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKL
QEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAV
GELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQ
ELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQ
NFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFS
GNGWNDDKCNLAKFWICKK
SAASCSRDEEQFLSPAPATPNPPPA
Sequence length 404
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Virion - Human immunodeficiency virus
Virion - Flavivirus and Alphavirus
Virion - Ebolavirus, Lyssavirus and Morbillivirus
Virion - Lassa virus and SFTS virus
Phagosome
C-type lectin receptor signaling pathway
Tuberculosis
Measles
  CD209 (DC-SIGN) signaling
Butyrophilin (BTN) family interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CD209-related disorder Benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Dengue fever, protection against protective; risk factor ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Dengue virus, susceptibility to Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEPATITIS C CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anemia Sickle Cell Sickle cell anemia Pubtator 29100978 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 28377641
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis Pubtator 35095831 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Juvenile Juvenile arthritis Pubtator 21526507 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Psoriatic Psoriatic arthritis Pubtator 35095831 Stimulate
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 12571844, 21953583, 24023637, 33792986 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 24023637 Inhibit
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 35095831 Stimulate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 21988460 Associate
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis Pubtator 28607410 Associate
★☆☆☆☆
Found in Text Mining only