Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	30833
Gene name	5', 3'-nucleotidase, cytosolic
Gene symbol	NT5C
Synonyms (NCBI Gene)	DNTDNT1HEL74P5N2PN-IPN-IIUMPH2cdNdNT-1
Chromosome	17
Chromosome location	17q25.1
Summary	This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5` deoxyribonucleotides (dNTP) and 2`(3`)-dNTP and ribonucleotides, but not 5` ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in it

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044494	hsa-miR-320a	CLASH	23622248
MIRT708324	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT708323	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT708322	hsa-miR-938	HITS-CLIP	19536157
MIRT708321	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT708320	hsa-miR-4763-5p	HITS-CLIP	19536157
MIRT708319	hsa-miR-2861	HITS-CLIP	19536157
MIRT708317	hsa-miR-4417	HITS-CLIP	19536157
MIRT708318	hsa-miR-4265	HITS-CLIP	19536157
MIRT708316	hsa-miR-4296	HITS-CLIP	19536157
MIRT708315	hsa-miR-4322	HITS-CLIP	19536157
MIRT708324	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT708323	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT708322	hsa-miR-938	HITS-CLIP	19536157
MIRT708321	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT708320	hsa-miR-4763-5p	HITS-CLIP	19536157
MIRT708319	hsa-miR-2861	HITS-CLIP	19536157
MIRT708317	hsa-miR-4417	HITS-CLIP	19536157
MIRT708318	hsa-miR-4265	HITS-CLIP	19536157
MIRT708316	hsa-miR-4296	HITS-CLIP	19536157
MIRT708315	hsa-miR-4322	HITS-CLIP	19536157
MIRT2056805	hsa-miR-1226	CLIP-seq
MIRT2056806	hsa-miR-4640-5p	CLIP-seq
MIRT2056807	hsa-miR-4726-5p	CLIP-seq
MIRT2056808	hsa-miR-634	CLIP-seq
MIRT2056809	hsa-miR-663b	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000255	Process	Allantoin metabolic process	IEA
GO:0005634	Component	Nucleus	IDA	10681516
GO:0005737	Component	Cytoplasm	IDA	10681516
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006139	Process	Nucleobase-containing compound metabolic process	IEA
GO:0006204	Process	IMP catabolic process	IEA
GO:0006249	Process	DCMP catabolic process	IEA
GO:0008252	Function	Nucleotidase activity	IDA	10681516
GO:0008252	Function	Nucleotidase activity	IEA
GO:0008253	Function	5'-nucleotidase activity	IBA
GO:0008253	Function	5'-nucleotidase activity	IEA
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0009223	Process	Pyrimidine deoxyribonucleotide catabolic process	IBA
GO:0009223	Process	Pyrimidine deoxyribonucleotide catabolic process	IDA	10681516
GO:0009264	Process	Deoxyribonucleotide catabolic process	IEA
GO:0009264	Process	Deoxyribonucleotide catabolic process	IEA
GO:0016311	Process	Dephosphorylation	IDA	10681516
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IEA
GO:0019103	Function	Pyrimidine nucleotide binding	IDA	10681516
GO:0042802	Function	Identical protein binding	IPI	31515488, 32296183
GO:0043605	Process	Amide catabolic process	IEA
GO:0046050	Process	UMP catabolic process	IEA
GO:0046055	Process	DGMP catabolic process	IEA
GO:0046074	Process	DTMP catabolic process	IEA
GO:0046079	Process	DUMP catabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
191720	17144	ENSG00000125458

Q8TCD5

Protein name

5'(3')-deoxyribonucleotidase, cytosolic type (EC 3.1.3.-) (Cytosolic 5',3'-pyrimidine nucleotidase) (Deoxy-5'-nucleotidase 1) (dNT-1)

Protein function

Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP.

PDB

2I7D , 4L57 , 4YIH , 6G2N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06941	NT5C	3 → 195		Family

Tissue specificity

TISSUE SPECIFICITY: Detected in skeletal muscle, heart and pancreas. {ECO:0000269|PubMed:10681516}.

Sequence

MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADK
VASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHL
GPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRL
LSWSDNWREILDSKRGAAQRE

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Nicotinate and nicotinamide metabolism Metabolic pathways Nucleotide metabolism		Pyrimidine catabolism Purine catabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	27796734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	15968458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27796734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29428530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29428530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29428530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35894707	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30819895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	27796734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21737633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	15814641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	15814641		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	23993982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28472140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28472140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23874742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15136231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21737633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21737633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	22905093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11355310		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	27796734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	27796734		★★★★★ ★☆☆☆☆ Found in Text Mining only

NT5C (5', 3'-nucleotidase, cytosolic)