Gene Gene information from NCBI Gene database.
Entrez ID 30818
Gene name Potassium voltage-gated channel interacting protein 3
Gene symbol KCNIP3
Synonyms (NCBI Gene)
CSENDREAMKCHIP3
Chromosome 2
Chromosome location 2q11.1
Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domai
miRNA miRNA information provided by mirtarbase database.
205
miRTarBase ID miRNA Experiments Reference
MIRT608434 hsa-miR-3942-5p HITS-CLIP 23824327
MIRT608433 hsa-miR-4703-5p HITS-CLIP 23824327
MIRT608432 hsa-miR-3908 HITS-CLIP 23824327
MIRT667780 hsa-miR-26b-3p HITS-CLIP 23824327
MIRT608428 hsa-miR-6867-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10078534
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10078534
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604662 15523 ENSG00000115041
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2W7
Protein name Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)
Protein function Calcium-dependent transcriptional repressor that binds to the DRE element of genes including PDYN and FOS. Affinity for DNA is reduced upon binding to calcium and enhanced by binding to magnesium. Seems to be involved in nociception (By similari
PDB 2E6W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 105 158 EF-hand domain pair Domain
PF13499 EF-hand_7 164 240 EF-hand domain pair Domain
PF00036 EF-hand_1 166 194 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain. Widely expressed at lower levels. Expression levels are elevated in brain cortex regions affected by Alzheimer disease. {ECO:0000269|PubMed:14720210}.
Sequence
MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSIL
LRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSI
YDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQ

KDENIMSSMQLFENVI
Sequence length 256
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Phase 1 - inactivation of fast Na+ channels
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PARKINSON DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 40329537 Stimulate
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 29253881, 30679616
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder BEFREE 29498457
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 29498457
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 29229094, 29398640
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 23596202, 23596205, 24386073, 25249324, 28166222, 29211761, 30372442, 30898381, 31198954
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 32977823 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Ovarian Epithelial Epithelial ovarian carcinoma Pubtator 28031411 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 28031411, 30206359
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular Diseases BEFREE 24796340, 31318648
★☆☆☆☆
Found in Text Mining only