Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	30818
Gene name	Potassium voltage-gated channel interacting protein 3
Gene symbol	KCNIP3
Synonyms (NCBI Gene)	CSENDREAMKCHIP3
Chromosome	2
Chromosome location	2q11.1
Summary	This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domai

205

Show/Hide all (205)

miRTarBase ID	miRNA	Experiments	Reference
MIRT608434	hsa-miR-3942-5p	HITS-CLIP	23824327
MIRT608433	hsa-miR-4703-5p	HITS-CLIP	23824327
MIRT608432	hsa-miR-3908	HITS-CLIP	23824327
MIRT667780	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT608428	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608427	hsa-miR-4766-3p	HITS-CLIP	23824327
MIRT667779	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT667778	hsa-miR-507	HITS-CLIP	23824327
MIRT667777	hsa-miR-557	HITS-CLIP	23824327
MIRT667776	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT667775	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT608426	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT608434	hsa-miR-3942-5p	HITS-CLIP	24906430
MIRT608433	hsa-miR-4703-5p	HITS-CLIP	24906430
MIRT608432	hsa-miR-3908	HITS-CLIP	24906430
MIRT608431	hsa-miR-889-5p	HITS-CLIP	24906430
MIRT608430	hsa-miR-7974	HITS-CLIP	24906430
MIRT608429	hsa-miR-4687-3p	HITS-CLIP	24906430
MIRT608428	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608427	hsa-miR-4766-3p	HITS-CLIP	24906430
MIRT608426	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608432	hsa-miR-3908	HITS-CLIP	27418678
MIRT608434	hsa-miR-3942-5p	HITS-CLIP	27418678
MIRT608433	hsa-miR-4703-5p	HITS-CLIP	27418678
MIRT608427	hsa-miR-4766-3p	HITS-CLIP	27418678
MIRT608426	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608428	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608434	hsa-miR-3942-5p	HITS-CLIP	23824327
MIRT608433	hsa-miR-4703-5p	HITS-CLIP	23824327
MIRT608432	hsa-miR-3908	HITS-CLIP	23824327
MIRT667780	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT608428	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608427	hsa-miR-4766-3p	HITS-CLIP	23824327
MIRT667779	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT667778	hsa-miR-507	HITS-CLIP	23824327
MIRT667777	hsa-miR-557	HITS-CLIP	23824327
MIRT667776	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT667775	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT608426	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT1081145	hsa-miR-1200	CLIP-seq
MIRT1081146	hsa-miR-1245b-5p	CLIP-seq
MIRT1081147	hsa-miR-1827	CLIP-seq
MIRT1081148	hsa-miR-1976	CLIP-seq
MIRT1081149	hsa-miR-3142	CLIP-seq
MIRT1081150	hsa-miR-4324	CLIP-seq
MIRT1081151	hsa-miR-4649-3p	CLIP-seq
MIRT1081152	hsa-miR-544b	CLIP-seq
MIRT1081153	hsa-miR-877	CLIP-seq
MIRT1081154	hsa-miR-1275	CLIP-seq
MIRT1081155	hsa-miR-3689d	CLIP-seq
MIRT1081156	hsa-miR-371b-3p	CLIP-seq
MIRT1081157	hsa-miR-4290	CLIP-seq
MIRT1081158	hsa-miR-4330	CLIP-seq
MIRT1081159	hsa-miR-4487	CLIP-seq
MIRT1081160	hsa-miR-4651	CLIP-seq
MIRT1081161	hsa-miR-4665-5p	CLIP-seq
MIRT1081162	hsa-miR-4693-3p	CLIP-seq
MIRT1081163	hsa-miR-578	CLIP-seq
MIRT1081164	hsa-miR-608	CLIP-seq
MIRT1081165	hsa-miR-635	CLIP-seq
MIRT1081166	hsa-miR-663b	CLIP-seq
MIRT2020109	hsa-miR-1205	CLIP-seq
MIRT2020110	hsa-miR-136	CLIP-seq
MIRT2020111	hsa-miR-19a	CLIP-seq
MIRT2020112	hsa-miR-19b	CLIP-seq
MIRT2020113	hsa-miR-2113	CLIP-seq
MIRT2020114	hsa-miR-218	CLIP-seq
MIRT2020115	hsa-miR-3074-5p	CLIP-seq
MIRT2020116	hsa-miR-3140-3p	CLIP-seq
MIRT2020117	hsa-miR-3667-3p	CLIP-seq
MIRT2020118	hsa-miR-4297	CLIP-seq
MIRT2020119	hsa-miR-4419a	CLIP-seq
MIRT2020120	hsa-miR-4510	CLIP-seq
MIRT2020121	hsa-miR-4659a-5p	CLIP-seq
MIRT2020122	hsa-miR-4659b-5p	CLIP-seq
MIRT2020123	hsa-miR-4708-3p	CLIP-seq
MIRT2020124	hsa-miR-4722-3p	CLIP-seq
MIRT2020125	hsa-miR-4757-5p	CLIP-seq
MIRT2020126	hsa-miR-4769-3p	CLIP-seq
MIRT2020127	hsa-miR-4802-5p	CLIP-seq
MIRT2020128	hsa-miR-636	CLIP-seq
MIRT2020129	hsa-miR-885-5p	CLIP-seq
MIRT2020110	hsa-miR-136	CLIP-seq
MIRT2020130	hsa-miR-4326	CLIP-seq
MIRT2020129	hsa-miR-885-5p	CLIP-seq
MIRT2251932	hsa-miR-1	CLIP-seq
MIRT2251933	hsa-miR-103a	CLIP-seq
MIRT2251934	hsa-miR-107	CLIP-seq
MIRT2251935	hsa-miR-1207-3p	CLIP-seq
MIRT2251936	hsa-miR-1207-5p	CLIP-seq
MIRT2251937	hsa-miR-1343	CLIP-seq
MIRT2020110	hsa-miR-136	CLIP-seq
MIRT2251938	hsa-miR-1909	CLIP-seq
MIRT2020111	hsa-miR-19a	CLIP-seq
MIRT2020112	hsa-miR-19b	CLIP-seq
MIRT2251939	hsa-miR-206	CLIP-seq
MIRT2020113	hsa-miR-2113	CLIP-seq
MIRT2020114	hsa-miR-218	CLIP-seq
MIRT2251940	hsa-miR-2392	CLIP-seq
MIRT2020116	hsa-miR-3140-3p	CLIP-seq
MIRT2251941	hsa-miR-3184	CLIP-seq
MIRT2251942	hsa-miR-323-5p	CLIP-seq
MIRT2251943	hsa-miR-338-3p	CLIP-seq
MIRT1081155	hsa-miR-3689d	CLIP-seq
MIRT2251944	hsa-miR-3690	CLIP-seq
MIRT2251945	hsa-miR-3913-3p	CLIP-seq
MIRT2251946	hsa-miR-423-5p	CLIP-seq
MIRT2251947	hsa-miR-4254	CLIP-seq
MIRT2020130	hsa-miR-4326	CLIP-seq
MIRT2251948	hsa-miR-4455	CLIP-seq
MIRT2251949	hsa-miR-4530	CLIP-seq
MIRT2251950	hsa-miR-4534	CLIP-seq
MIRT2251951	hsa-miR-4640-3p	CLIP-seq
MIRT2251952	hsa-miR-4736	CLIP-seq
MIRT2251953	hsa-miR-4763-3p	CLIP-seq
MIRT2020127	hsa-miR-4802-5p	CLIP-seq
MIRT2251954	hsa-miR-489	CLIP-seq
MIRT2251955	hsa-miR-613	CLIP-seq
MIRT2020128	hsa-miR-636	CLIP-seq
MIRT2251956	hsa-miR-646	CLIP-seq
MIRT2251957	hsa-miR-876-3p	CLIP-seq
MIRT2020129	hsa-miR-885-5p	CLIP-seq
MIRT2020109	hsa-miR-1205	CLIP-seq
MIRT2251936	hsa-miR-1207-5p	CLIP-seq
MIRT2251938	hsa-miR-1909	CLIP-seq
MIRT2020111	hsa-miR-19a	CLIP-seq
MIRT2020112	hsa-miR-19b	CLIP-seq
MIRT2020113	hsa-miR-2113	CLIP-seq
MIRT2020114	hsa-miR-218	CLIP-seq
MIRT2251940	hsa-miR-2392	CLIP-seq
MIRT2020116	hsa-miR-3140-3p	CLIP-seq
MIRT1081155	hsa-miR-3689d	CLIP-seq
MIRT2389635	hsa-miR-4268	CLIP-seq
MIRT2389636	hsa-miR-4448	CLIP-seq
MIRT2251950	hsa-miR-4534	CLIP-seq
MIRT2251952	hsa-miR-4736	CLIP-seq
MIRT2389637	hsa-miR-4758-3p	CLIP-seq
MIRT2251953	hsa-miR-4763-3p	CLIP-seq
MIRT2020127	hsa-miR-4802-5p	CLIP-seq
MIRT2389638	hsa-miR-485-5p	CLIP-seq
MIRT2020128	hsa-miR-636	CLIP-seq
MIRT2020129	hsa-miR-885-5p	CLIP-seq
MIRT2020109	hsa-miR-1205	CLIP-seq
MIRT2020110	hsa-miR-136	CLIP-seq
MIRT2020125	hsa-miR-4757-5p	CLIP-seq
MIRT2020129	hsa-miR-885-5p	CLIP-seq
MIRT2555222	hsa-miR-3064-5p	CLIP-seq
MIRT2555223	hsa-miR-3652	CLIP-seq
MIRT2251944	hsa-miR-3690	CLIP-seq
MIRT2555224	hsa-miR-378	CLIP-seq
MIRT2555225	hsa-miR-378b	CLIP-seq
MIRT2555226	hsa-miR-378c	CLIP-seq
MIRT2555227	hsa-miR-378d	CLIP-seq
MIRT2555228	hsa-miR-378e	CLIP-seq
MIRT2555229	hsa-miR-378f	CLIP-seq
MIRT2555230	hsa-miR-378h	CLIP-seq
MIRT2555231	hsa-miR-378i	CLIP-seq
MIRT2555232	hsa-miR-422a	CLIP-seq
MIRT2251947	hsa-miR-4254	CLIP-seq
MIRT2555233	hsa-miR-4283	CLIP-seq
MIRT2555234	hsa-miR-4430	CLIP-seq
MIRT2555235	hsa-miR-4489	CLIP-seq
MIRT2555236	hsa-miR-4505	CLIP-seq
MIRT2555237	hsa-miR-4731-5p	CLIP-seq
MIRT2251935	hsa-miR-1207-3p	CLIP-seq
MIRT2683209	hsa-miR-1226	CLIP-seq
MIRT2683210	hsa-miR-1253	CLIP-seq
MIRT2683211	hsa-miR-1285	CLIP-seq
MIRT2555222	hsa-miR-3064-5p	CLIP-seq
MIRT2251941	hsa-miR-3184	CLIP-seq
MIRT2683212	hsa-miR-3187-5p	CLIP-seq
MIRT2683213	hsa-miR-3192	CLIP-seq
MIRT2555223	hsa-miR-3652	CLIP-seq
MIRT2683214	hsa-miR-3656	CLIP-seq
MIRT2683215	hsa-miR-3689a-3p	CLIP-seq
MIRT2683216	hsa-miR-3689c	CLIP-seq
MIRT2251944	hsa-miR-3690	CLIP-seq
MIRT2555224	hsa-miR-378	CLIP-seq
MIRT2555225	hsa-miR-378b	CLIP-seq
MIRT2555226	hsa-miR-378c	CLIP-seq
MIRT2555227	hsa-miR-378d	CLIP-seq
MIRT2555228	hsa-miR-378e	CLIP-seq
MIRT2555229	hsa-miR-378f	CLIP-seq
MIRT2555230	hsa-miR-378h	CLIP-seq
MIRT2555231	hsa-miR-378i	CLIP-seq
MIRT2555232	hsa-miR-422a	CLIP-seq
MIRT2251946	hsa-miR-423-5p	CLIP-seq
MIRT2251947	hsa-miR-4254	CLIP-seq
MIRT2555233	hsa-miR-4283	CLIP-seq
MIRT2020119	hsa-miR-4419a	CLIP-seq
MIRT2555234	hsa-miR-4430	CLIP-seq
MIRT2683217	hsa-miR-4434	CLIP-seq
MIRT2683218	hsa-miR-4446-3p	CLIP-seq
MIRT2555235	hsa-miR-4489	CLIP-seq
MIRT2683219	hsa-miR-4492	CLIP-seq
MIRT2683220	hsa-miR-4498	CLIP-seq
MIRT2555236	hsa-miR-4505	CLIP-seq
MIRT2020120	hsa-miR-4510	CLIP-seq
MIRT2683221	hsa-miR-4516	CLIP-seq
MIRT2683222	hsa-miR-4721	CLIP-seq
MIRT2683223	hsa-miR-4728-5p	CLIP-seq
MIRT2555237	hsa-miR-4731-5p	CLIP-seq
MIRT2683224	hsa-miR-612	CLIP-seq
MIRT2683225	hsa-miR-762	CLIP-seq
MIRT2683226	hsa-miR-885-3p	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10078534
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10078534
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	10078534
GO:0005267	Function	Potassium channel activity	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	10900016
GO:0005515	Function	Protein binding	IPI	16189514, 17189291, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	10900016
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0072659	Process	Protein localization to plasma membrane	ISS
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IBA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	ISS

MIM	HGNC	e!Ensembl
604662	15523	ENSG00000115041

Q9Y2W7

Protein name

Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)

Protein function

Calcium-dependent transcriptional repressor that binds to the DRE element of genes including PDYN and FOS. Affinity for DNA is reduced upon binding to calcium and enhanced by binding to magnesium. Seems to be involved in nociception (By similari

PDB

2E6W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13833	EF-hand_8	105 → 158	EF-hand domain pair	Domain
PF13499	EF-hand_7	164 → 240	EF-hand domain pair	Domain
PF00036	EF-hand_1	166 → 194	EF hand	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain. Widely expressed at lower levels. Expression levels are elevated in brain cortex regions affected by Alzheimer disease. {ECO:0000269|PubMed:14720210}.

Sequence

MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQ
KDENIMSSMQLFENVI

Sequence length

256

Interactions

View interactions

	Reactome
			Phase 1 - inactivation of fast Na+ channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	40329537	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29253881, 30679616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29498457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29498457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29229094, 29398640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23596202, 23596205, 24386073, 25249324, 28166222, 29211761, 30372442, 30898381, 31198954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32977823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28031411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28031411, 30206359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24796340, 31318648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29119925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35131032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31318648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18507845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30221615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	LHGDN	12648752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	30179599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28031411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	11278424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Follicular cyst	Pubtator	29641740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23786773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31318648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30206359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29523177, 31086218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30474909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	17189291		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12217801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23596202, 23596205, 24386073, 25249324, 28166222, 29211761, 30372442, 30898381, 31198954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30206359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27892959, 28031411, 28988802, 29073279, 29125603, 30206359, 30833638		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31538818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	31591222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27510319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29125603, 31591222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11094064, 12676525, 21852538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	30451831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28952229		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30206359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33755733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	28572607, 28977491, 29125603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30221615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	31047111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29125603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27549343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	30221615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	29641740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29641740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Variegate Porphyria	Variegate Porphyria	BEFREE	31026452		★★★★★ ★☆☆☆☆ Found in Text Mining only

KCNIP3 (potassium voltage-gated channel interacting protein 3)